SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_001185756.1.60453 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_001185756.1.60453
Domain Number 1 Region: 3-245
Classification Level Classification E-value
Superfamily CutC-like 9.15e-77
Family CutC-like 0.000000000471
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_001185756.1.60453
Sequence length 248
Comment MULTISPECIES: copper homeostasis protein CutC [Shigella]; AA=GCF_000020185.1; RF=na; TAX=344609; STAX=621; NAME=Shigella boydii CDC 3083-94; strain=BS512; CDC 3083-94; AL=Complete Genome; RT=Major
Sequence
MALLEICCYSMECALTAQQNGADRVELCAAPKEGGLTPSLGVLKSVRQWVTIPVHPIIRP
RGGDFCYSDGEFAAILEDVLTVRELGFPGLVTGVLDVDGNVDMPRMEKIMAAAGPLAVTF
HRAFDMCANPLNTLSNLAELGIARVLTSGQKSDALQGLSKIMELIAHRDAPIIMAGAGVR
AENLHHFLDAGVLEVHSSAGAWQASPMRYRNQGLSMSSDAHADEYSRYVVDGAAVAEMKG
IIERHQAK
Download sequence
Identical sequences B2U4X5
344609.SbBS512_E2167 gi|187731122|ref|YP_001880684.1| WP_001185756.1.14129 WP_001185756.1.19129 WP_001185756.1.28536 WP_001185756.1.3598 WP_001185756.1.37967 WP_001185756.1.41271 WP_001185756.1.49104 WP_001185756.1.51307 WP_001185756.1.54585 WP_001185756.1.57851 WP_001185756.1.60453 WP_001185756.1.62266 WP_001185756.1.68731 WP_001185756.1.71149 WP_001185756.1.79464 WP_001185756.1.79922

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]