SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_001206856.1.54470 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_001206856.1.54470
Domain Number 1 Region: 3-258
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.37e-62
Family Pyruvate oxidase and decarboxylase Pyr module 0.035
Further Details:      
 
Domain Number 2 Region: 268-375
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 2.83e-17
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_001206856.1.54470
Sequence length 375
Comment 2-oxoglutarate synthase subunit alpha [Helicobacter pylori]; AA=GCF_002148385.1; RF=na; TAX=102617; STAX=210; NAME=Helicobacter pylori SS1; strain=SS1; AL=Contig; RT=Major
Sequence
MREIISDGNELVAKAAIEVGCRFFGGYPITPSSDIMHAMSVALPKCGGHFIQMEDEISGI
SVSLGASMSGTKSMTASSGPGISLKVEQIGYSFMAEIPLVIADVMRSGPSTGMPTRVAQG
DVNFLRHPIHGDFKAVALAPANLEEAYTETVRAFNLAEMLMTPVFLLMDETVGHMYGKVQ
IPDLEEVQKMTINRKEFLGDKKDYKPYGVAQDEPAVLNPFFKGYRYHVSGLHHGPIGFPT
EDAKIGGDLIDRLFNKIESKQDIINENEEMDLEGAEIVVIAYGSVSLAVKEALKDYHKES
KQKVGFFRPKTLWPSPAKRLKEIGDKYEKILVIELNKGQYLEEIERAMQRKVHFLGQANG
RTISPKQIIAKLKEL
Download sequence
Identical sequences A0A1Y3E186 A0A2J9KJF6 O25311
gi|410501590|ref|YP_006936117.1| gi|410023823|ref|YP_006893076.1| gi|15645214|ref|NP_207384.1| NP_207384.1.64343 WP_001206856.1.100370 WP_001206856.1.12929 WP_001206856.1.14785 WP_001206856.1.15441 WP_001206856.1.15770 WP_001206856.1.16964 WP_001206856.1.18045 WP_001206856.1.21161 WP_001206856.1.21640 WP_001206856.1.23156 WP_001206856.1.23346 WP_001206856.1.26233 WP_001206856.1.26656 WP_001206856.1.27034 WP_001206856.1.29892 WP_001206856.1.30129 WP_001206856.1.32874 WP_001206856.1.32920 WP_001206856.1.32991 WP_001206856.1.34734 WP_001206856.1.34950 WP_001206856.1.37759 WP_001206856.1.3847 WP_001206856.1.3935 WP_001206856.1.45128 WP_001206856.1.45388 WP_001206856.1.45788 WP_001206856.1.46484 WP_001206856.1.47666 WP_001206856.1.51993 WP_001206856.1.53728 WP_001206856.1.54470 WP_001206856.1.56818 WP_001206856.1.5696 WP_001206856.1.58727 WP_001206856.1.61092 WP_001206856.1.63400 WP_001206856.1.64394 WP_001206856.1.65101 WP_001206856.1.65885 WP_001206856.1.66907 WP_001206856.1.6783 WP_001206856.1.71693 WP_001206856.1.73531 WP_001206856.1.74411 WP_001206856.1.7512 WP_001206856.1.76964 WP_001206856.1.77110 WP_001206856.1.77453 WP_001206856.1.78022 WP_001206856.1.79031 WP_001206856.1.79522 WP_001206856.1.81922 WP_001206856.1.84468 WP_001206856.1.85386 WP_001206856.1.85662 WP_001206856.1.85747 WP_001206856.1.87485 WP_001206856.1.88001 WP_001206856.1.88687 WP_001206856.1.8903 WP_001206856.1.93861 WP_001206856.1.94773 WP_001206856.1.95955 WP_001206856.1.97942 WP_001206856.1.98792 WP_001206856.1.98910 WP_001206856.1.990 gi|15645214|ref|NP_207384.1| 85962.HP0589

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]