SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_001238333.1.82395 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_001238333.1.82395
Domain Number 1 Region: 224-328
Classification Level Classification E-value
Superfamily TPR-like 1.71e-16
Family Tetratricopeptide repeat (TPR) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_001238333.1.82395
Sequence length 347
Comment cytochrome c biogenesis protein CcmH [Salmonella enterica]; AA=GCF_002052355.1; RF=na; TAX=28901; STAX=28901; NAME=Salmonella enterica; strain=BCW_5264; AL=Contig; RT=Major
Sequence
MRLLPGMVMLMLVLVIAGSARATTDVMPFKDEAQEQQFRQLTEQLRCPKCQNNSIADSNA
MIATDMRRRVYDLMQEGKSRQEIIDYMVARYGNFVTYDPPLTPLTVLLWVLPLATIVAGG
WIIVARTRRRVRIRQDVLADAIPAAGPRAGWGAYVPGVVMALVVAAISYSQTGSYPQVRA
WQQATAQTPGLLARALDPQAQPLNEEEMARLALGLRTRLQNDAGNVEGWLMLGRTGMVLG
NAGTATGAYANAYRLDPKNRDAALGYAEALTRSSDPEDNRRGGELLRQLVSRDHTDIRVL
SLYAFSAFEQQRFGEAVAAWEMMLKLLPAGDARRAVIERSIRLAQEK
Download sequence
Identical sequences A0A0F6B3X6 A0A0H3NF44 A0A249USG6 A0A2D3GC55 A0A2J9K9K4 E8XDT8 Q8ZNI0
gi|378989634|ref|YP_005252798.1| gi|378991114|ref|YP_005254278.1| gi|379701479|ref|YP_005243207.1| ABAO01000015|CDS_24643-23600 AE006468|CDS_2348436-2347393 CP000886|CDS_3962246-3961203 CP000886|CDS_697387-698430 CP001363|CDS_2399989-2398946 FN424405|CDS_2372102-2371059 gi|161613038|ref|YP_001587003.1| gi|161616927|ref|YP_001590892.1| 272994.SPAB_00745 272994.SPAB_04748 99287.STM2247 gi|378450954|ref|YP_005238313.1| gi|16765575|ref|NP_461190.1| gi|378700158|ref|YP_005182115.1| NP_461190.1.58477 WP_001238333.1.101042 WP_001238333.1.101841 WP_001238333.1.10191 WP_001238333.1.10521 WP_001238333.1.14379 WP_001238333.1.14852 WP_001238333.1.16244 WP_001238333.1.18949 WP_001238333.1.19706 WP_001238333.1.2010 WP_001238333.1.2235 WP_001238333.1.28170 WP_001238333.1.28938 WP_001238333.1.30238 WP_001238333.1.3119 WP_001238333.1.31578 WP_001238333.1.33825 WP_001238333.1.35503 WP_001238333.1.3756 WP_001238333.1.3848 WP_001238333.1.39197 WP_001238333.1.40380 WP_001238333.1.4239 WP_001238333.1.42864 WP_001238333.1.43528 WP_001238333.1.44640 WP_001238333.1.4775 WP_001238333.1.4885 WP_001238333.1.48876 WP_001238333.1.49515 WP_001238333.1.52047 WP_001238333.1.54033 WP_001238333.1.54400 WP_001238333.1.56414 WP_001238333.1.56682 WP_001238333.1.58745 WP_001238333.1.58803 WP_001238333.1.62076 WP_001238333.1.6423 WP_001238333.1.67829 WP_001238333.1.70914 WP_001238333.1.71116 WP_001238333.1.71248 WP_001238333.1.72203 WP_001238333.1.7433 WP_001238333.1.77960 WP_001238333.1.79659 WP_001238333.1.80959 WP_001238333.1.82395 WP_001238333.1.85617 WP_001238333.1.85672 WP_001238333.1.85976 WP_001238333.1.87095 WP_001238333.1.90734 WP_001238333.1.91655 WP_001238333.1.92443 WP_001238333.1.93101 WP_001238333.1.95546 WP_001238333.1.97369 WP_001238333.1.99072 gi|378984810|ref|YP_005247965.1| gi|378445678|ref|YP_005233310.1| gi|526220808|ref|YP_008266494.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]