SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_001831247.1.5131 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_001831247.1.5131
Domain Number 1 Region: 3-279
Classification Level Classification E-value
Superfamily DAK1/DegV-like 1.31e-88
Family DegV-like 0.0000299
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_001831247.1.5131
Sequence length 282
Comment MULTISPECIES: hypothetical protein [Staphylococcus]; AA=GCF_001659305.1; RF=na; TAX=1282; STAX=1282; NAME=Staphylococcus epidermidis; strain=ENVP605; AL=Contig; RT=Major
Sequence
MAKQIIVTDSTSDLSHEYLKQHNIHVIPLSLTIDGKSYTDQVDISSSEYIDHIENDADVK
TSQPPIGRFIETYEQLAQDDVEIISIHLSSGLSGTYNTAVQASHMVDGNITVIDSKSISF
GLGYQIKQIVELISQGTSTEEIVKEMTQLRDNLQLFVVIGQLNQLIKGGRISKTKGLIGN
IMKIKPIGTLRDGKLELVHNSRTQNSSVQYLKKEITDFVKDHKIKSIGIAHANVKDFVDK
IIKSFTESFDFSQFDINVTTPVISTHTGQGAIGLVVLRDTLN
Download sequence
Identical sequences A0A0H2VG92 A0A0Y1X506 A0A2G8HQD8 D4FIQ9 Q5HPB2 W1VWE5
176279.SERP1001 176280.SE1118 APC20791 gi|27468036|ref|NP_764673.1| NP_764673.1.96214 WP_001831247.1.100050 WP_001831247.1.10021 WP_001831247.1.100433 WP_001831247.1.100549 WP_001831247.1.100800 WP_001831247.1.101292 WP_001831247.1.101732 WP_001831247.1.10200 WP_001831247.1.10516 WP_001831247.1.1066 WP_001831247.1.10880 WP_001831247.1.11039 WP_001831247.1.11097 WP_001831247.1.1172 WP_001831247.1.12195 WP_001831247.1.12399 WP_001831247.1.12633 WP_001831247.1.13993 WP_001831247.1.1487 WP_001831247.1.14999 WP_001831247.1.15050 WP_001831247.1.15264 WP_001831247.1.15608 WP_001831247.1.15634 WP_001831247.1.15776 WP_001831247.1.15975 WP_001831247.1.16031 WP_001831247.1.16425 WP_001831247.1.16888 WP_001831247.1.1734 WP_001831247.1.17536 WP_001831247.1.17589 WP_001831247.1.1780 WP_001831247.1.17932 WP_001831247.1.18322 WP_001831247.1.18820 WP_001831247.1.19169 WP_001831247.1.19525 WP_001831247.1.19634 WP_001831247.1.19747 WP_001831247.1.20829 WP_001831247.1.2143 WP_001831247.1.2266 WP_001831247.1.2308 WP_001831247.1.23129 WP_001831247.1.23748 WP_001831247.1.23933 WP_001831247.1.24537 WP_001831247.1.25104 WP_001831247.1.2587 WP_001831247.1.26079 WP_001831247.1.26136 WP_001831247.1.26763 WP_001831247.1.26887 WP_001831247.1.27021 WP_001831247.1.27273 WP_001831247.1.27634 WP_001831247.1.2771 WP_001831247.1.27875 WP_001831247.1.28189 WP_001831247.1.28279 WP_001831247.1.29015 WP_001831247.1.29043 WP_001831247.1.29900 WP_001831247.1.30044 WP_001831247.1.30228 WP_001831247.1.30590 WP_001831247.1.31449 WP_001831247.1.31487 WP_001831247.1.32060 WP_001831247.1.32657 WP_001831247.1.33508 WP_001831247.1.34082 WP_001831247.1.34374 WP_001831247.1.34705 WP_001831247.1.34758 WP_001831247.1.35206 WP_001831247.1.35778 WP_001831247.1.36104 WP_001831247.1.36293 WP_001831247.1.36528 WP_001831247.1.36840 WP_001831247.1.3698 WP_001831247.1.37506 WP_001831247.1.37668 WP_001831247.1.38364 WP_001831247.1.3910 WP_001831247.1.39158 WP_001831247.1.39520 WP_001831247.1.40194 WP_001831247.1.41570 WP_001831247.1.4163 WP_001831247.1.41640 WP_001831247.1.42083 WP_001831247.1.42781 WP_001831247.1.43309 WP_001831247.1.43463 WP_001831247.1.43835 WP_001831247.1.44582 WP_001831247.1.44772 WP_001831247.1.45275 WP_001831247.1.45384 WP_001831247.1.45515 WP_001831247.1.45766 WP_001831247.1.45985 WP_001831247.1.46159 WP_001831247.1.46517 WP_001831247.1.46639 WP_001831247.1.4677 WP_001831247.1.47347 WP_001831247.1.47465 WP_001831247.1.48665 WP_001831247.1.48672 WP_001831247.1.50086 WP_001831247.1.50102 WP_001831247.1.50141 WP_001831247.1.50545 WP_001831247.1.5131 WP_001831247.1.51353 WP_001831247.1.51852 WP_001831247.1.53182 WP_001831247.1.53858 WP_001831247.1.54624 WP_001831247.1.55323 WP_001831247.1.5653 WP_001831247.1.57676 WP_001831247.1.57912 WP_001831247.1.57980 WP_001831247.1.58920 WP_001831247.1.59220 WP_001831247.1.59696 WP_001831247.1.60263 WP_001831247.1.604 WP_001831247.1.60968 WP_001831247.1.62056 WP_001831247.1.62209 WP_001831247.1.62552 WP_001831247.1.63141 WP_001831247.1.63339 WP_001831247.1.63714 WP_001831247.1.64636 WP_001831247.1.65535 WP_001831247.1.65731 WP_001831247.1.66623 WP_001831247.1.66725 WP_001831247.1.67105 WP_001831247.1.67262 WP_001831247.1.68456 WP_001831247.1.687 WP_001831247.1.69187 WP_001831247.1.69281 WP_001831247.1.69584 WP_001831247.1.69743 WP_001831247.1.70385 WP_001831247.1.70534 WP_001831247.1.70703 WP_001831247.1.70755 WP_001831247.1.71096 WP_001831247.1.72059 WP_001831247.1.72202 WP_001831247.1.72549 WP_001831247.1.7287 WP_001831247.1.72908 WP_001831247.1.72948 WP_001831247.1.73271 WP_001831247.1.74694 WP_001831247.1.75166 WP_001831247.1.75578 WP_001831247.1.75757 WP_001831247.1.76151 WP_001831247.1.76766 WP_001831247.1.7796 WP_001831247.1.78204 WP_001831247.1.78266 WP_001831247.1.79087 WP_001831247.1.79415 WP_001831247.1.80118 WP_001831247.1.80311 WP_001831247.1.80534 WP_001831247.1.81223 WP_001831247.1.81614 WP_001831247.1.81804 WP_001831247.1.81818 WP_001831247.1.82021 WP_001831247.1.82199 WP_001831247.1.8237 WP_001831247.1.82807 WP_001831247.1.83976 WP_001831247.1.84232 WP_001831247.1.84248 WP_001831247.1.85164 WP_001831247.1.85372 WP_001831247.1.85735 WP_001831247.1.86391 WP_001831247.1.87036 WP_001831247.1.87531 WP_001831247.1.87968 WP_001831247.1.88436 WP_001831247.1.8850 WP_001831247.1.8890 WP_001831247.1.89313 WP_001831247.1.90573 WP_001831247.1.91726 WP_001831247.1.91956 WP_001831247.1.92120 WP_001831247.1.92296 WP_001831247.1.92313 WP_001831247.1.92414 WP_001831247.1.93985 WP_001831247.1.94055 WP_001831247.1.95589 WP_001831247.1.96627 WP_001831247.1.96673 WP_001831247.1.96799 WP_001831247.1.97286 WP_001831247.1.97364 WP_001831247.1.9749 WP_001831247.1.97896 WP_001831247.1.98568 WP_001831247.1.99474 gi|57866917|ref|YP_188578.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]