SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_002010467.1.4354 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_002010467.1.4354
Domain Number 1 Region: 227-351
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000000286
Family Tetratricopeptide repeat (TPR) 0.0075
Further Details:      
 
Domain Number 2 Region: 7-65
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.00000000000816
Family Phage repressors 0.052
Further Details:      
 
Domain Number 3 Region: 153-257
Classification Level Classification E-value
Superfamily TPR-like 0.00000327
Family Tetratricopeptide repeat (TPR) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_002010467.1.4354
Sequence length 419
Comment MULTISPECIES: transcriptional regulator [Bacillus cereus group]; AA=GCF_000293605.1; RF=na; TAX=1053197; STAX=1396; NAME=Bacillus cereus BtB2-4; strain=BtB2-4; AL=Scaffold; RT=Major
Sequence
MQQTLEKIGKQVFYKRLQQKMTQEELCQGICSVSYLSKIENGKIEASEEILQLLCTRLEI
AVTDLRDVEEDVKVKLDEWLNALVHLDKQQVERIYEELQGEMKHVLDFEIINYYKLLYTR
YLMMKRDLPAVEEELDGLKKVYKKYSPFQKMLYTYNKALLYSVQYKYTQALEYLLKTESM
AKELGYYETGIYYNLALTYSQMEIDHMTLYFANVALEGFKSEYKFRNIINCKFLIAFSYT
RKKQYNEAMEIYNHIIREATSFADKDNILSIALNNIGYLYYRQKNYAKAKEYYIECLKYK
KEEDMNYIDAMYELSLQCIQLGELEEAAEWIEKGILAARKDDRYKGMLYLLLNLRYKYFE
ERDLYKKFLETEVVPFFKTEENIKDLKKVYLELAEYLEECSDFKESNRYYKLAITLLEE
Download sequence
Identical sequences A0A084IYZ2 A0A1I6BLF9 A0A1S9TP87 A9VTT2 C2PR55 C2XPA2 J7W3B2 J8D4M2 J8HHW5 J8IBM1 J8L099 J8L2Q9 J8MX15 J9CU21 R8CR87 R8F098
gi|163938522|ref|YP_001643406.1| 315730.BcerKBAB4_0512 WP_002010467.1.100646 WP_002010467.1.11324 WP_002010467.1.20051 WP_002010467.1.21695 WP_002010467.1.27729 WP_002010467.1.27732 WP_002010467.1.28299 WP_002010467.1.2902 WP_002010467.1.2904 WP_002010467.1.35095 WP_002010467.1.37635 WP_002010467.1.37801 WP_002010467.1.38645 WP_002010467.1.39896 WP_002010467.1.4354 WP_002010467.1.46157 WP_002010467.1.47674 WP_002010467.1.50411 WP_002010467.1.52845 WP_002010467.1.63476 WP_002010467.1.6426 WP_002010467.1.68668 WP_002010467.1.75292 WP_002010467.1.76817 WP_002010467.1.79293 WP_002010467.1.82832 WP_002010467.1.8290 WP_002010467.1.85012 WP_002010467.1.85187 WP_002010467.1.86789 WP_002010467.1.87416 WP_002010467.1.99558 WP_002010467.1.99908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]