SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_002014952.1.20881 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_002014952.1.20881
Domain Number 1 Region: 1-305
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 4.32e-85
Family RNase Z-like 0.0000000167
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_002014952.1.20881
Sequence length 307
Comment MULTISPECIES: ribonuclease Z [Bacillus cereus group]; AA=GCF_000832605.1; RF=representative genome; TAX=1405; STAX=1405; NAME=Bacillus mycoides; strain=ATCC 6462; AL=Complete Genome; RT=Major
Sequence
MEFVFLGTGAGVPSKGRNVSAIALQLLEERGQTWLFDCGEATQHQILHTSVRPRRIEKIF
ITHLHGDHIFGLPGLLGSRSFQGGTTKLTVYGPKGIKQFIEVALLVSTTHVKYPLEIVEI
TEEGIVFEDNEFCVETKRLSHGIECFGYRIVEKDIQGALLVDKLLGMGVKPGPVFKRLKD
GEVVELENGTVLDGKDFIGPPQKGRVITILGDTRYCEASRELAQDADVLVHEATFAAEDE
QQAYDYFHSTSKQAASIALQANAKRLILTHISSRYQGDTYKELLKEARELFSNTEIATDL
KSFPVER
Download sequence
Identical sequences A0A084J3A6 A0A150C3C4 A0A243A481 A9VG79 C2Q0J1 C2SPU0 J7ZCU5 J8FIJ4 J8IJ58 R8I3T5 W4DRA4
WP_002014952.1.10033 WP_002014952.1.100649 WP_002014952.1.11324 WP_002014952.1.17940 WP_002014952.1.20881 WP_002014952.1.21695 WP_002014952.1.28299 WP_002014952.1.30061 WP_002014952.1.31050 WP_002014952.1.35095 WP_002014952.1.36226 WP_002014952.1.38645 WP_002014952.1.39255 WP_002014952.1.39896 WP_002014952.1.4354 WP_002014952.1.4496 WP_002014952.1.47957 WP_002014952.1.54007 WP_002014952.1.57105 WP_002014952.1.59016 WP_002014952.1.63476 WP_002014952.1.6426 WP_002014952.1.64566 WP_002014952.1.68186 WP_002014952.1.79293 WP_002014952.1.85012 WP_002014952.1.85187 WP_002014952.1.86789 WP_002014952.1.87416 WP_002014952.1.93582 WP_002014952.1.99558 WP_002014952.1.99908 gi|163941883|ref|YP_001646767.1| 315730.BcerKBAB4_3973

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]