SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_002015497.1.75292 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_002015497.1.75292
Domain Number 1 Region: 1-75,165-340
Classification Level Classification E-value
Superfamily Phosphoenolpyruvate/pyruvate domain 1.88e-103
Family Pyruvate kinase 0.000000267
Further Details:      
 
Domain Number 2 Region: 321-473
Classification Level Classification E-value
Superfamily PK C-terminal domain-like 1.96e-42
Family Pyruvate kinase, C-terminal domain 0.00084
Further Details:      
 
Domain Number 3 Region: 465-583
Classification Level Classification E-value
Superfamily Phosphohistidine domain 9.03e-31
Family Pyruvate phosphate dikinase, central domain 0.027
Further Details:      
 
Domain Number 4 Region: 70-165
Classification Level Classification E-value
Superfamily PK beta-barrel domain-like 5.93e-27
Family Pyruvate kinase beta-barrel domain 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_002015497.1.75292
Sequence length 585
Comment MULTISPECIES: pyruvate kinase [Bacillus cereus group]; AA=GCF_002200005.1; RF=na; TAX=1405; STAX=1405; NAME=Bacillus mycoides; strain=MOD1_Bc228; AL=Scaffold; RT=Major
Sequence
MRKTKIVCTIGPASESIEKLEQLMEAGMNVARLNFSHGSHEEHGARIKNIREASKKTGKT
VGILLDTKGPEIRTHDFVDGQAELVTGAEVILSTEQVLGTAEKFSVSYAGLYDDVDPGSR
ILIDDGLIELEVIEKADGNIRTKVLNSGTVKNKKGVNVPNVSIKLPGITEKDVQDIVFGI
EQKVDFIAASFVRKASDVLEIRELLEGHNAQYIQIVPKIENQEGIDNIDSILEVSDGLMV
ARGDMGVEIPPEEVPLVQKRLIKKCNVLGKPVITATQMLDSMQRNPRPTRAEASDVANAI
FDGTDAIMLSGETAAGQYPVEAVTMMANIAVRVEKSLQYEDMFKKRIKEFTPTITDAISQ
SVAHTALALDVAAIVAPTESGHTAKMISKYRPKSPIVAVTSDEQVGRRLALVWGVQAFMS
EKRAASTDEMLDTAIQTGMDAGLIGLGDTVVITAGVPVAETGTTNLMKIHVVGEKVAKGQ
GIGRKSAKGKVVVAKTAAEAVANVNKGDILVTTSTDKDMIPAIEKAAALVVEEGGLTSHA
AVVGVSIGIPVIVGVNGVTTTLKNGQEVTVDAARGIVYNGHAEVL
Download sequence
Identical sequences A0A084IW44 A0A1I5X885 A0A243A3L7 A9VJR0 C2Q1S2 C2SR53 J8CT80 J8F788 J8IZP7 J8KRV9 J8NQZ4 J8PXG6 R8EK16 R8H6T5 R8MKI3 W4DNJ9
gi|163942331|ref|YP_001647215.1| 315730.BcerKBAB4_4428 WP_002015497.1.10033 WP_002015497.1.100646 WP_002015497.1.17940 WP_002015497.1.20051 WP_002015497.1.20881 WP_002015497.1.21695 WP_002015497.1.27729 WP_002015497.1.27732 WP_002015497.1.28299 WP_002015497.1.2902 WP_002015497.1.2904 WP_002015497.1.30061 WP_002015497.1.35095 WP_002015497.1.36226 WP_002015497.1.37635 WP_002015497.1.37801 WP_002015497.1.38645 WP_002015497.1.39255 WP_002015497.1.4354 WP_002015497.1.4496 WP_002015497.1.45835 WP_002015497.1.46157 WP_002015497.1.47674 WP_002015497.1.47957 WP_002015497.1.57105 WP_002015497.1.60236 WP_002015497.1.63476 WP_002015497.1.6426 WP_002015497.1.64566 WP_002015497.1.68186 WP_002015497.1.72867 WP_002015497.1.75292 WP_002015497.1.79293 WP_002015497.1.82832 WP_002015497.1.8290 WP_002015497.1.85012 WP_002015497.1.85187 WP_002015497.1.86789 WP_002015497.1.87416 WP_002015497.1.99558 WP_002015497.1.99908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]