SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_002016114.1.82832 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_002016114.1.82832
Domain Number 1 Region: 1-115
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 5.49e-24
Family DNA-binding N-terminal domain of transcription activators 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_002016114.1.82832
Sequence length 122
Comment MULTISPECIES: MerR family transcriptional regulator [Bacillus]; AA=GCF_002146775.1; RF=na; TAX=180892; STAX=1428; NAME=Bacillus thuringiensis serovar asturiensis; strain=BGSC 4BQ1; AL=Contig; RT=Major
Sequence
MRIGELSKETGVSERALRHYEEKGLLPSKRLANGYRDFDESAIEKVELIQMYLQIGLNLE
ETERMLRCLEIEPHLYENPCSSILALYEDKLDEVTKQITLLSNIQTNLQKHVSLLKQAKE
KG
Download sequence
Identical sequences A0A0A0WS13 A0A1I6BDU3 A0A1K0ADQ9 A0A1S9TMV6 A0A243AAH9 A9VQ90 C2Q3B3 C2SSM5 C2Y1P2 J7T7Q9 J8HKC7 J8J6L2 R8CSF3 R8EG28 R8HJC0
WP_002016114.1.10033 WP_002016114.1.100646 WP_002016114.1.11324 WP_002016114.1.17940 WP_002016114.1.20051 WP_002016114.1.20881 WP_002016114.1.21695 WP_002016114.1.27729 WP_002016114.1.28299 WP_002016114.1.2902 WP_002016114.1.30061 WP_002016114.1.31050 WP_002016114.1.37635 WP_002016114.1.38645 WP_002016114.1.39317 WP_002016114.1.39896 WP_002016114.1.4354 WP_002016114.1.4496 WP_002016114.1.45835 WP_002016114.1.52845 WP_002016114.1.57105 WP_002016114.1.6426 WP_002016114.1.64566 WP_002016114.1.65515 WP_002016114.1.68186 WP_002016114.1.72867 WP_002016114.1.75292 WP_002016114.1.76817 WP_002016114.1.79293 WP_002016114.1.82832 WP_002016114.1.85187 WP_002016114.1.86789 WP_002016114.1.87416 WP_002016114.1.93582 WP_002016114.1.99558 WP_002016114.1.99908 gi|163942861|ref|YP_001647745.1| 315730.BcerKBAB4_4970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]