SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_002030329.1.21695 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_002030329.1.21695
Domain Number 1 Region: 133-300
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 1.41e-29
Family Gyrase inhibitory protein GyrI (SbmC, YeeB) 0.03
Further Details:      
 
Domain Number 2 Region: 58-115
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000000134
Family AraC type transcriptional activator 0.0024
Further Details:      
 
Domain Number 3 Region: 7-56
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000968
Family AraC type transcriptional activator 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_002030329.1.21695
Sequence length 300
Comment MULTISPECIES: AraC family transcriptional regulator [Bacillus cereus group]; AA=GCF_002118175.1; RF=na; TAX=1405; STAX=1405; NAME=Bacillus mycoides; strain=S2E19; AL=Contig; RT=Major
Sequence
MESYETQIQRSIDYIEEDVMEKQTLRNLARVAGFSESHFHRVFQALVGDTVMEYVRKRRL
ARAAYQLSHTDEKVIDIAFEHGFQSHETFTRAFKKLFQMTPSEYRKQEIETPMYYRVNVK
QRKLNPYLGGIQMEYRIVNKPEFLMAGYELKTTSKEGKNHQDIPAFWQEYLQKDLGTTIP
NRKDTSQWVELGLCTDFNLETGDFTYIIGMEVTDFENVPNAVAKRTFPAATYAVFTTPKV
PHEEMVSSIHQTWNAVFSEWFPHSGYEHCGVNEFELYDERSHADKSEFAQIELWIPVKKK
Download sequence
Identical sequences A0A0A0WQL8 A0A1S9TPQ8 A0A243ANZ8 A9VIY3 C2SGK5 J8CLI9 J8NMY4 R8HS08 R8N7V3
gi|163939016|ref|YP_001643900.1| 315730.BcerKBAB4_1021 WP_002030329.1.100649 WP_002030329.1.11324 WP_002030329.1.17940 WP_002030329.1.21695 WP_002030329.1.27732 WP_002030329.1.2904 WP_002030329.1.30061 WP_002030329.1.37635 WP_002030329.1.4496 WP_002030329.1.47957 WP_002030329.1.57105 WP_002030329.1.60236 WP_002030329.1.64566 WP_002030329.1.72867 WP_002030329.1.75292 WP_002030329.1.82832 WP_002030329.1.8290 WP_002030329.1.85012 WP_002030329.1.99908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]