SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_002033406.1.86789 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_002033406.1.86789
Domain Number 1 Region: 24-236
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 2.88e-38
Family Methyl parathion hydrolase 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_002033406.1.86789
Sequence length 250
Comment MULTISPECIES: N-acyl homoserine lactonase [Bacillus cereus group]; AA=GCF_002014535.1; RF=na; TAX=86662; STAX=86662; NAME=Bacillus weihenstephanensis; strain=FSL W7-1108; AL=Contig; RT=Major
Sequence
MTVKKLYFVPAGRCMLDHSSVNSTLTPGDLLNLPVWCYLLETEEGPILVDTGMPESAVNN
EDLFNGTFVEGHILPKMTEEDRIINILKRVGYEPEDLLYIISSHLHFDHAGGNGAFTNTP
IIVQRAEYEAAQYSEEYMKECILPNLKYKIIEGDYEVVPGVQLLYTPGHTPGHQSLLIET
EKSGPVLLTIDASYTKENFEDEVPFAGFDSELALSSIKRLKEVVRKENPIVFFGHDIEQE
KSCKVFPEYI
Download sequence
Identical sequences A0A0A0WPM2 A9VMR9 C2SMX4 J7WUJ3 J8CYC3
WP_002033406.1.30061 WP_002033406.1.4496 WP_002033406.1.52845 WP_002033406.1.57105 WP_002033406.1.59016 WP_002033406.1.85012 WP_002033406.1.86789 WP_002033406.1.99908 gi|163941086|ref|YP_001645970.1| 315730.BcerKBAB4_3166

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]