SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_002034214.1.8290 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_002034214.1.8290
Domain Number 1 Region: 68-186
Classification Level Classification E-value
Superfamily RmlC-like cupins 2.67e-17
Family Probable transcriptional regulator VC1968, C-terminal domain 0.019
Further Details:      
 
Domain Number 2 Region: 12-76
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 7.88e-17
Family Probable transcriptional regulator VC1968, N-terminal domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_002034214.1.8290
Sequence length 190
Comment MULTISPECIES: XRE family transcriptional regulator [Bacillus cereus group]; AA=GCF_000290695.1; RF=na; TAX=1053247; STAX=1396; NAME=Bacillus cereus VDM022; strain=VDM022; AL=Scaffold; RT=Major
Sequence
MKENEDMQTKEVIQQVGQLLRQIRNEQKLSLEELAQKTGVSKLTLGKIERGETNPTLAVI
WKITKGLSIPLSRLMVVGEPVAVARCGEGFAVDVGQAWHLETMFRYTKETGMEMHRACLR
ANSIYEPEAHHEGAIELVTVMKGKVSIQVENDVYVLNEFDSIQFEANKKHSYKNEEDEVA
VLHLTMKYSS
Download sequence
Identical sequences A0A084IV23 A0A1I5XEY8 A0A243A356 A9VIW2 C2SQW0 J7WJ51 J8C1Z3 J8J2P3 J8KDF4 J8P8Q9 J8PCM7 R8D0B7 R8ELQ9 R8H4Q3 R8MN11 W4DN97
315730.BcerKBAB4_4333 WP_002034214.1.10033 WP_002034214.1.100646 WP_002034214.1.100649 WP_002034214.1.17940 WP_002034214.1.20051 WP_002034214.1.20881 WP_002034214.1.21695 WP_002034214.1.27729 WP_002034214.1.27732 WP_002034214.1.2902 WP_002034214.1.2904 WP_002034214.1.30061 WP_002034214.1.31050 WP_002034214.1.35095 WP_002034214.1.36226 WP_002034214.1.37635 WP_002034214.1.37801 WP_002034214.1.38645 WP_002034214.1.39317 WP_002034214.1.4354 WP_002034214.1.4496 WP_002034214.1.45835 WP_002034214.1.46157 WP_002034214.1.47674 WP_002034214.1.47957 WP_002034214.1.52845 WP_002034214.1.57105 WP_002034214.1.59016 WP_002034214.1.60236 WP_002034214.1.63476 WP_002034214.1.6426 WP_002034214.1.64566 WP_002034214.1.68186 WP_002034214.1.72867 WP_002034214.1.75292 WP_002034214.1.82832 WP_002034214.1.8290 WP_002034214.1.85012 WP_002034214.1.85187 WP_002034214.1.87416 WP_002034214.1.99558 WP_002034214.1.99908 gi|163942236|ref|YP_001647120.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]