SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_002084410.1.2902 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_002084410.1.2902
Domain Number 1 Region: 2-65
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 2.95e-18
Family SinR domain-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_002084410.1.2902
Sequence length 66
Comment MULTISPECIES: transcriptional regulator [Bacillus cereus group]; AA=GCF_000399045.1; RF=na; TAX=1053246; STAX=1396; NAME=Bacillus cereus VDM019; strain=VDM019; AL=Scaffold; RT=Major
Sequence
MAFVTKIKEYRAKVHMTQEDLAKKVGVRRETISHLEKGKYNPSLQLAHDIARALHSTIDE
VFIFED
Download sequence
Identical sequences A0A084IVN7 A0A150C7T0 A0A1I6BZ33 A0A243AH49 A9VLY0 J7WZX6 J7ZIY9 J8HS75 J8IPW3 J8KKE3 J8L963 J8NJT1 R8CQ83 R8ER06 R8HX33 W4EFN8
gi|163940990|ref|YP_001645874.1| WP_002084410.1.100646 WP_002084410.1.100649 WP_002084410.1.11324 WP_002084410.1.17940 WP_002084410.1.20051 WP_002084410.1.20881 WP_002084410.1.21695 WP_002084410.1.27729 WP_002084410.1.27732 WP_002084410.1.28299 WP_002084410.1.2902 WP_002084410.1.2904 WP_002084410.1.35095 WP_002084410.1.36226 WP_002084410.1.37635 WP_002084410.1.37801 WP_002084410.1.38645 WP_002084410.1.39255 WP_002084410.1.39317 WP_002084410.1.39896 WP_002084410.1.4354 WP_002084410.1.45835 WP_002084410.1.46157 WP_002084410.1.47674 WP_002084410.1.47957 WP_002084410.1.52845 WP_002084410.1.54007 WP_002084410.1.59016 WP_002084410.1.63476 WP_002084410.1.6426 WP_002084410.1.64566 WP_002084410.1.68186 WP_002084410.1.72867 WP_002084410.1.73166 WP_002084410.1.75292 WP_002084410.1.76817 WP_002084410.1.79293 WP_002084410.1.82832 WP_002084410.1.8290 WP_002084410.1.85012 WP_002084410.1.85187 WP_002084410.1.86789 WP_002084410.1.87416 WP_002084410.1.93582 WP_002084410.1.99558 WP_002084410.1.99908 315730.BcerKBAB4_3066

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]