SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_002128234.1.68186 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_002128234.1.68186
Domain Number 1 Region: 7-114
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 8.06e-23
Family DNA-binding N-terminal domain of transcription activators 0.0025
Further Details:      
 
Domain Number 2 Region: 126-269
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 0.000000000863
Family Multidrug-binding domain of transcription activator BmrR 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_002128234.1.68186
Sequence length 277
Comment MULTISPECIES: MerR family transcriptional regulator [Bacillus cereus group]; AA=GCF_000003925.1; RF=na; TAX=526997; STAX=1405; NAME=Bacillus mycoides DSM 2048; strain=DSM 2048; AL=Chromosome; RT=Major
Sequence
MDSYKLTKSDVIKIFNTTKETLRFYEEKGLVQPKVGKNNYRLYGNEDLQRISQIFFCKDM
GFSIEEIDLVINKRNIINNMNILQNKKNEIETEIHRFMEVQKKITRLLDLLQNRSRNFNK
IQSVYFEERKYYHIKGENFNSVKSFFDKFRSIFKQGEFFQEQFITMCPIKNFFNDDLGLS
VYYPVLNDTEMEHVDILSIPAGNYLCVDYVCTEGHMDEARRQIYTNIKDYIKRNGLQFRS
CNVIESDLHGLNLFYPEGQIIMNMQIPVEEKSKHQEK
Download sequence
Identical sequences A0A0B5SH84 A0A1I6CGI7 A9VLT3 J8FEB2 R8ES92 R8MVB7
WP_002128234.1.100646 WP_002128234.1.20051 WP_002128234.1.20881 WP_002128234.1.27729 WP_002128234.1.2902 WP_002128234.1.38645 WP_002128234.1.4354 WP_002128234.1.60236 WP_002128234.1.63476 WP_002128234.1.6426 WP_002128234.1.68186 WP_002128234.1.75292 WP_002128234.1.82832 WP_002128234.1.85187 WP_002128234.1.87416 WP_002128234.1.99558 WP_002128234.1.99908 315730.BcerKBAB4_3016 gi|163940943|ref|YP_001645827.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]