SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_002140332.1.86789 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_002140332.1.86789
Domain Number - Region: 42-149
Classification Level Classification E-value
Superfamily FliG 0.0259
Family FliG 0.012
Further Details:      
 
Domain Number - Region: 8-44
Classification Level Classification E-value
Superfamily Stathmin 0.0837
Family Stathmin 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_002140332.1.86789
Sequence length 160
Comment MULTISPECIES: hypothetical protein [Bacillus cereus group]; AA=GCF_002014535.1; RF=na; TAX=86662; STAX=86662; NAME=Bacillus weihenstephanensis; strain=FSL W7-1108; AL=Contig; RT=Major
Sequence
MAKEITLIKKKIVTEEEKKQQVTDELLNDLAENREAVEETMQLLAQLQKAGILDAAISLL
AAKEDVSKIAVEQLNREPVKNALNNMMGAGEALSSVDPEITKQITSSLVTGLQFATEELN
SGKKTKVMDFFKVLKDPDINRAITFGFSFLKAFGQGLEKK
Download sequence
Identical sequences A0A084IYY4 A0A150CF72 A9VTS3 J8DE30 J8P260 J8PIW9 R8HPN7 R8NJX1 W4DXF5
gi|163938513|ref|YP_001643397.1| WP_002140332.1.10033 WP_002140332.1.100649 WP_002140332.1.17940 WP_002140332.1.27732 WP_002140332.1.35095 WP_002140332.1.36226 WP_002140332.1.37635 WP_002140332.1.38645 WP_002140332.1.46157 WP_002140332.1.47674 WP_002140332.1.47957 WP_002140332.1.54007 WP_002140332.1.59016 WP_002140332.1.60236 WP_002140332.1.85012 WP_002140332.1.86789 WP_002140332.1.93582 WP_002140332.1.99908 315730.BcerKBAB4_0503

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]