SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_002140676.1.17940 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_002140676.1.17940
Domain Number 1 Region: 6-107
Classification Level Classification E-value
Superfamily SpoIIaa-like 7.06e-24
Family Anti-sigma factor antagonist SpoIIaa 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_002140676.1.17940
Sequence length 112
Comment MULTISPECIES: anti-anti-sigma factor [Bacillus cereus group]; AA=GCF_000399145.1; RF=na; TAX=1053224; STAX=1396; NAME=Bacillus cereus VD021; strain=VD021; AL=Scaffold; RT=Major
Sequence
MMNLAINILQNDLGYTVQLNGEIDAYTASDLKNKVMPIASEKEVYIVVDFNKVDYMDSTG
LGVFIALLKAIKKNDGKLEFIGVSRRLKRLFDITGLTEILNLNSDFEKVERR
Download sequence
Identical sequences A9VHF9 J8D1W2 R8HQ21
315730.BcerKBAB4_0901 gi|163938898|ref|YP_001643782.1| WP_002140676.1.17940

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]