SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_002140896.1.86789 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_002140896.1.86789
Domain Number 1 Region: 2-63
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 1.98e-18
Family SinR domain-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_002140896.1.86789
Sequence length 71
Comment MULTISPECIES: transcriptional regulator [Bacillus cereus group]; AA=GCF_002014535.1; RF=na; TAX=86662; STAX=86662; NAME=Bacillus weihenstephanensis; strain=FSL W7-1108; AL=Contig; RT=Major
Sequence
MENKMVEYRKKFGLSQEKLAEKLGVSRQTIISIEKGKYDPSLPLAFEIAKAFQTTIEHVF
IYEGKEEGEKG
Download sequence
Identical sequences A0A150BQX8 A0A1S9TCZ0 A9VJY0 J8D0V8 R8N9I1
WP_002140896.1.21695 WP_002140896.1.39255 WP_002140896.1.54007 WP_002140896.1.60236 WP_002140896.1.85012 WP_002140896.1.86789 WP_002140896.1.99908 315730.BcerKBAB4_1167 gi|163939160|ref|YP_001644044.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]