SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_002142594.1.99908 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_002142594.1.99908
Domain Number 1 Region: 1-113
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.000000000000952
Family DNA-binding N-terminal domain of transcription activators 0.013
Further Details:      
 
Weak hits

Sequence:  WP_002142594.1.99908
Domain Number - Region: 257-390
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 0.0272
Family Plant O-methyltransferase, C-terminal domain 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_002142594.1.99908
Sequence length 410
Comment MULTISPECIES: MerR family transcriptional regulator [Bacillus cereus group]; AA=GCF_000018825.1; RF=na; TAX=315730; STAX=86662; NAME=Bacillus weihenstephanensis KBAB4; strain=KBAB4; AL=Complete Genome; RT=Major
Sequence
MKIGTFAKLFHVTTDTVRYYIELGLLIPDKKNTQYQMNQLCFDDMTFITELKKFHFSLIE
IQRILSYRRVTNFSDHEDIDYYNNSLIDKKDELTKKKEDISKAIQLIEKAVQTSSPSSKE
ESITGIPLDFVNFLYCPKCRIPLEMKDVTIKKVYIHTGSLTCSCGYEAAIEEGIIITANL
YETSPYPSYFYDKETIKEINPKMINLFEKSNFRFQKVLQNIDLKNKLIVETNVDAFVSLP
KYIDVLEPSANYVFSGYSLAMLKKVRNRIERMNPKPRVLYILNSDLNLPLKPLSIDVFVD
SFTITDFSLLNPEFPSHVLKNYLHNSSTIVGGYSYYDNSAKSLKNISALYPNSHEHILHP
KYLEENLSVNGFQIMQNENIGYCTDPGPYFDYHVRDEKFHMLMYLANTKQ
Download sequence
Identical sequences A0A1S9T587 A9VMT1 J7ZHI5
gi|163941098|ref|YP_001645982.1| WP_002142594.1.85012 WP_002142594.1.86789 WP_002142594.1.99908 315730.BcerKBAB4_3178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]