SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_002143649.1.17940 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_002143649.1.17940
Domain Number 1 Region: 12-227
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 6.68e-44
Family Zn metallo-beta-lactamase 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_002143649.1.17940
Sequence length 240
Comment MULTISPECIES: MBL fold metallo-hydrolase [Bacillus cereus group]; AA=GCF_000399145.1; RF=na; TAX=1053224; STAX=1396; NAME=Bacillus cereus VD021; strain=VD021; AL=Scaffold; RT=Major
Sequence
MRMMHEKTVYQLSFLPRVFPVNCYFVEEEDGLTLIDAALPYSTKGILQAAEKIGKPITKI
VLTHAHDDHIGALDALKEVLPNVPVYISKRDAKLLEGDTTLQKDEPNIPIKGGVPKKVKT
VPDVLLEDGDRVGSLLAIMTPGHTPGSMSLLDVRNKALIVGDAFQTRGGMAVSGQMKFWF
PFPAMATWSKEISLQSAEKLSEYEPSLLAAGHGKMIKDPGTVIKLAIKEAKRNIESRKEG
Download sequence
Identical sequences A9VP11 J8BX32 R8HKP7
gi|163942724|ref|YP_001647608.1| 315730.BcerKBAB4_4832 WP_002143649.1.17940 WP_002143649.1.85012 WP_002143649.1.99908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]