SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_002190122.1.47674 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_002190122.1.47674
Domain Number 1 Region: 35-274
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 1.11e-25
Family RNase Z-like 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_002190122.1.47674
Sequence length 283
Comment MULTISPECIES: MBL fold metallo-hydrolase [Bacillus cereus group]; AA=GCF_000290655.1; RF=na; TAX=1053250; STAX=1396; NAME=Bacillus cereus VDM062; strain=VDM062; AL=Scaffold; RT=Major
Sequence
MKIKSLKLYDTGYCTHPEKIAYSKGSWKQISFPATVGLLQHPVLGYILFDTGYAGHFKEA
TKKFPYSVYAKLTPVHFTEEQSIKQQLLLDGIQPEEIKYIILSHFHGDHTAGLPDFPKAK
ILTFAKAYEDIKKRSKFGALLKGCLKDTLPMDLEERMSFIDQTSSLNLPSTYGKFEEGYD
VFDDGSLFAVDLTGHATGQFGLFVHLQSNKIVFLCADAVWLSKTYQNLVFPSKIANLLTS
DPKSYRKNIEKLHHLSQTSPEIEIVPTHCEHTWDKIKVGVYYE
Download sequence
Identical sequences A9VL41 J8P4B8 J8PMR2
WP_002190122.1.46157 WP_002190122.1.47674 WP_002190122.1.99908 315730.BcerKBAB4_2956 gi|163940886|ref|YP_001645770.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]