SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_002229530.1.26452 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_002229530.1.26452
Domain Number 1 Region: 139-425
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 2.83e-128
Family Enolase 0.0000000202
Further Details:      
 
Domain Number 2 Region: 3-136
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 8.99e-58
Family Enolase N-terminal domain-like 0.0000032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_002229530.1.26452
Sequence length 428
Comment enolase [Neisseria meningitidis]; AA=GCF_900033145.1; RF=na; TAX=487; STAX=487; NAME=Neisseria meningitidis; strain=2842STDY5881322; AL=Scaffold; RT=Major
Sequence
MSAIVDIFAREILDSRGNPTVECDVLLESGVMGRAAVPSGASTGQKEALELRDGDKSRYS
GKGVLKAVEHVNNQIAQALIGIDANEQSYIDQIMIELDGTENKGNLGANATLAVSMAVAR
AAAEDSGLPLYRYLGGAGPMSLPVPMMNVINGGEHANNSLNIQEFMIMPVGAKSFREALR
CGAEIFHALKKLCDSKGFPTTVGDEGGFAPNLNSHKEALQLMVEATEAAGYKAGEDVLFA
LDCASSEFYKDGKYHLEAEGRSYTNAEFAEYLESLVNEFPIISIEDGMDENDWEGWKLLT
EKLGGKVQLVGDDLFVTNPKILAEGIEKGVANALLVKVNQIGTLSETLKAVDLAKRNRYA
SVMSHRSGETEDSTIADLAVATNCMQIKTGSLSRSDRMAKYNQLLRIEEELAEAADYPGK
AAFYQLGK
Download sequence
Identical sequences A0A1V3SP59 A9LZL4 C6S7C9
gi|161870159|ref|YP_001599329.1| 374833.NMCC_1198 662598.NMO_1128 WP_002229530.1.10028 WP_002229530.1.101951 WP_002229530.1.11132 WP_002229530.1.11805 WP_002229530.1.13809 WP_002229530.1.14004 WP_002229530.1.15053 WP_002229530.1.17756 WP_002229530.1.18603 WP_002229530.1.19488 WP_002229530.1.23799 WP_002229530.1.24407 WP_002229530.1.26137 WP_002229530.1.26210 WP_002229530.1.26452 WP_002229530.1.30166 WP_002229530.1.30955 WP_002229530.1.32267 WP_002229530.1.32417 WP_002229530.1.35797 WP_002229530.1.38837 WP_002229530.1.42572 WP_002229530.1.43776 WP_002229530.1.43810 WP_002229530.1.4434 WP_002229530.1.48136 WP_002229530.1.54176 WP_002229530.1.54250 WP_002229530.1.54816 WP_002229530.1.55176 WP_002229530.1.60113 WP_002229530.1.62826 WP_002229530.1.63953 WP_002229530.1.65953 WP_002229530.1.67167 WP_002229530.1.6772 WP_002229530.1.68040 WP_002229530.1.69994 WP_002229530.1.73775 WP_002229530.1.75448 WP_002229530.1.773 WP_002229530.1.80981 WP_002229530.1.82858 WP_002229530.1.82998 WP_002229530.1.8554 WP_002229530.1.86905 WP_002229530.1.88347 WP_002229530.1.8844 WP_002229530.1.88522 WP_002229530.1.90103 WP_002229530.1.91720 WP_002229530.1.93142 WP_002229530.1.93332 WP_002229530.1.9441 WP_002229530.1.94970 WP_002229530.1.98186 WP_002229530.1.98836 gi|254805089|ref|YP_003083310.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]