SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_002236992.1.46359 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_002236992.1.46359
Domain Number 1 Region: 72-134
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000017
Family NfeD domain-like 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_002236992.1.46359
Sequence length 135
Comment membrane protein [Neisseria meningitidis]; AA=GCF_000386125.2; RF=na; TAX=1145121; STAX=487; NAME=Neisseria meningitidis 70021; strain=70021; AL=Contig; RT=Major
Sequence
MTVWFVAAVAVLIIELLTGTVYLLVVSAALAGSGIAYGLTGSTPAAVLTAALLSALGIWF
VHAKTAVGKVETDSYQDLDAGQYAEILRHAGGNRYEVFYRGTHWQAQNTGQEELEPGTRA
LIVRKEGNLLIIAKP
Download sequence
Identical sequences A0A0H5QE60 A0A0U1RJ01
gi|385851180|ref|YP_005897695.1| 122587.NMA1383 WP_002236992.1.101880 WP_002236992.1.13538 WP_002236992.1.13760 WP_002236992.1.14015 WP_002236992.1.14401 WP_002236992.1.14606 WP_002236992.1.20071 WP_002236992.1.21274 WP_002236992.1.25760 WP_002236992.1.25838 WP_002236992.1.27167 WP_002236992.1.29411 WP_002236992.1.3102 WP_002236992.1.33274 WP_002236992.1.34468 WP_002236992.1.38013 WP_002236992.1.42614 WP_002236992.1.43517 WP_002236992.1.44409 WP_002236992.1.45832 WP_002236992.1.46359 WP_002236992.1.5069 WP_002236992.1.56890 WP_002236992.1.67110 WP_002236992.1.67186 WP_002236992.1.68056 WP_002236992.1.69069 WP_002236992.1.69435 WP_002236992.1.76226 WP_002236992.1.7807 WP_002236992.1.81964 WP_002236992.1.86488 WP_002236992.1.91073 WP_002236992.1.92972 WP_002236992.1.93999 WP_002236992.1.96240 gi|218768225|ref|YP_002342737.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]