SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_002358483.1.82202 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_002358483.1.82202
Domain Number 1 Region: 4-63
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 3.79e-20
Family SinR domain-like 0.0000969
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_002358483.1.82202
Sequence length 66
Comment MULTISPECIES: transcriptional regulator [Enterococcus]; AA=GCF_001999625.1; RF=na; TAX=1201292; STAX=1351; NAME=Enterococcus faecalis ATCC 29212; strain=ATCC 29212; AL=Contig; RT=Major
Sequence
MIINNLKLIREKKKISQSELAALLEVSRQTINGIEKNKYNPSLQLALKIAYYLNTPLEDI
FQWQPE
Download sequence
Identical sequences A0A059N669 A0A0M2ANP8 C7CX31 C7WX42 E0HG46 E2YYK8 Q8VL32 R3GZ65
000002772|e1utxA1|101.1.4.64|A:1-66 000046238|e1utxB1|101.1.4.64|B:1-66 000046239|e2gzuA1|101.1.4.64|A:1-66 000046240|e2gzuB1|101.1.4.64|B:1-66 000142298|e2xi8A1|101.1.4.64|A:1-66 000223013|e2lyjA1|101.1.4.64|A:1-66 000412677|e2xi8B1|101.1.4.64|B:1-66 000978785|e2lyjB1|101.1.4.64|B:1-66 000978786|e2lyqA1|101.1.4.64|A:1-66 000978787|e2lykB1|101.1.4.64|B:1-66 000978788|e2lylB1|101.1.4.64|B:1-66 000978789|e2lyrA1|101.1.4.64|A:1-66 000978790|e2lypA1|101.1.4.64|A:1-66 000978791|e2lylA1|101.1.4.64|A:1-66 000978792|e2lykA1|101.1.4.64|A:1-66 000978793|e2lysA1|101.1.4.64|A:1-66 cath|current|1utxA00/1-66 cath|current|1utxB00/1-66 cath|current|2gzuA00/1-66 cath|current|2gzuB00/67-132 cath|current|2lyjA00/1-66 cath|current|2lyjB00/67-132 cath|current|2lykA00/1-66 cath|current|2lykB00/67-132 cath|current|2lylA00/1-66 cath|current|2lylB00/67-132 cath|current|2lypA00/1-66 cath|current|2lyqA00/1-66 cath|current|2lyrA00/1-66 cath|current|2lysA00/1-66 cath|current|2xi8A00/1-66 cath|current|2xi8B00/1-66 d1utxa_ d1utxb_ d2gzua_ d2gzub_ d2lyja_ d2lyjb_ d2lyka_ d2lykb_ d2lyla_ d2lylb_ d2lypa_ d2lyqa_ d2lyra_ d2lysa_ d2xi8a_ d2xi8b_ 1utx_A 1utx_B 2gzu_A 2gzu_B 2lyj_A 2lyj_B 2lyk_A 2lyk_B 2lyl_A 2lyl_B 2lyp_A 2lyq_A 2lyr_A 2lys_A 2xi8_A 2xi8_B 1utxA WP_002358483.1.100415 WP_002358483.1.101272 WP_002358483.1.13369 WP_002358483.1.15224 WP_002358483.1.17287 WP_002358483.1.17800 WP_002358483.1.18524 WP_002358483.1.19115 WP_002358483.1.19734 WP_002358483.1.22780 WP_002358483.1.23322 WP_002358483.1.23498 WP_002358483.1.23569 WP_002358483.1.24526 WP_002358483.1.24581 WP_002358483.1.28038 WP_002358483.1.28221 WP_002358483.1.30275 WP_002358483.1.33513 WP_002358483.1.33851 WP_002358483.1.34766 WP_002358483.1.36269 WP_002358483.1.40757 WP_002358483.1.42904 WP_002358483.1.43540 WP_002358483.1.44537 WP_002358483.1.46113 WP_002358483.1.46357 WP_002358483.1.48063 WP_002358483.1.51046 WP_002358483.1.53631 WP_002358483.1.54795 WP_002358483.1.54998 WP_002358483.1.57302 WP_002358483.1.57671 WP_002358483.1.58766 WP_002358483.1.59454 WP_002358483.1.59964 WP_002358483.1.60200 WP_002358483.1.60579 WP_002358483.1.65461 WP_002358483.1.66845 WP_002358483.1.69824 WP_002358483.1.70675 WP_002358483.1.70756 WP_002358483.1.71303 WP_002358483.1.74591 WP_002358483.1.7819 WP_002358483.1.78471 WP_002358483.1.79975 WP_002358483.1.80867 WP_002358483.1.80889 WP_002358483.1.81312 WP_002358483.1.82202 WP_002358483.1.83327 WP_002358483.1.83649 WP_002358483.1.84813 WP_002358483.1.86904 WP_002358483.1.87482 WP_002358483.1.89321 WP_002358483.1.91925 WP_002358483.1.92348 WP_002358483.1.92820 WP_002358483.1.93159 WP_002358483.1.93277 WP_002358483.1.94399 WP_002358483.1.94506 WP_002358483.1.96467 WP_002358483.1.96987 WP_002358483.1.9842 WP_002358483.1.99748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]