SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_002437221.1.15264 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_002437221.1.15264
Domain Number 1 Region: 2-362
Classification Level Classification E-value
Superfamily Homocysteine S-methyltransferase 9.55e-99
Family Homocysteine S-methyltransferase 0.00000447
Further Details:      
 
Domain Number 2 Region: 317-600
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 8.44e-64
Family Methylenetetrahydrofolate reductase 0.00091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_002437221.1.15264
Sequence length 612
Comment MULTISPECIES: bifunctional homocysteine S-methyltransferase/methylenetetrahydrofolate reductase [Staphylococcus]; AA=GCF_001071895.1; RF=na; TAX=1282; STAX=1282; NAME=Staphylococcus epidermidis; strain=237_SEPI; AL=Contig; RT=Major
Sequence
MSHLLNQLKSNVLVADGAIGTIFYSEGLDTCPESYNLTHPDKVERIHRSYIEAGADVIQT
NTYGANFEKLKSFGLEHKVKEIHQAAVQIAKHAANEDTIILGTVGGFRGVRQEDISLSTI
QYHTELQIDTLIDEGVDALLFETYYDLDELTRIVTATRQKYDIPIIAQLTASNTNYLVDG
TEINAALKYVVECGANVVGLNCHHGPHHMQRSFSHIELPKHAYLSCYPNASLLDIENSEF
KYSDNAQYFGDIAQELINEGVRLIGGCCGTTPEHIRYIKSAVKHLKPVKDKKVIPINKAS
SQKQTRVLKQNLTSKVKNGPTVIVELDTPKHLDTDTFFDNVGKLDEAGIDAVTLADNSLA
TVRVSNIAAASLIKQRYDIEPLVHVTCRDRNLIGLQSHLLGLSLIGVNEILAITGDPSKV
GHLPGATNVYDVNSKGLTELALRFNKGINTDGDALKKHTNFNIAGAFDPNVRKLDGAIKR
LEKKVASGMSYFITQPVYSKEKIIQVYEETKHLNTPFFIGIMPIASYNNALFLHNEVPGI
KMSDDVLNQFKAVKDDKEKTKELSLRLSKELIDTVHEYFNGLYIITPFQKVDYSLELAAY
SKSITANKEAIL
Download sequence
Identical sequences A0A2G7IEH2 Q5HS04
176279.SERP0035 WP_002437221.1.100433 WP_002437221.1.100549 WP_002437221.1.100800 WP_002437221.1.101292 WP_002437221.1.12195 WP_002437221.1.12254 WP_002437221.1.13713 WP_002437221.1.13993 WP_002437221.1.1487 WP_002437221.1.15050 WP_002437221.1.15264 WP_002437221.1.17536 WP_002437221.1.19169 WP_002437221.1.19634 WP_002437221.1.2143 WP_002437221.1.2308 WP_002437221.1.23129 WP_002437221.1.2398 WP_002437221.1.23999 WP_002437221.1.24537 WP_002437221.1.26079 WP_002437221.1.26136 WP_002437221.1.26887 WP_002437221.1.27020 WP_002437221.1.27875 WP_002437221.1.30044 WP_002437221.1.30590 WP_002437221.1.33089 WP_002437221.1.33508 WP_002437221.1.33701 WP_002437221.1.34374 WP_002437221.1.3735 WP_002437221.1.37506 WP_002437221.1.37755 WP_002437221.1.39158 WP_002437221.1.40535 WP_002437221.1.40934 WP_002437221.1.41570 WP_002437221.1.4163 WP_002437221.1.41640 WP_002437221.1.43129 WP_002437221.1.43835 WP_002437221.1.44120 WP_002437221.1.44582 WP_002437221.1.44772 WP_002437221.1.45766 WP_002437221.1.46159 WP_002437221.1.47347 WP_002437221.1.4806 WP_002437221.1.48665 WP_002437221.1.50545 WP_002437221.1.51168 WP_002437221.1.52629 WP_002437221.1.53858 WP_002437221.1.56880 WP_002437221.1.57912 WP_002437221.1.59612 WP_002437221.1.60263 WP_002437221.1.604 WP_002437221.1.60471 WP_002437221.1.63714 WP_002437221.1.65731 WP_002437221.1.68211 WP_002437221.1.68665 WP_002437221.1.69281 WP_002437221.1.69584 WP_002437221.1.69585 WP_002437221.1.70534 WP_002437221.1.71072 WP_002437221.1.72059 WP_002437221.1.7287 WP_002437221.1.75383 WP_002437221.1.76151 WP_002437221.1.76766 WP_002437221.1.78204 WP_002437221.1.78266 WP_002437221.1.80285 WP_002437221.1.80313 WP_002437221.1.82021 WP_002437221.1.8237 WP_002437221.1.84232 WP_002437221.1.86391 WP_002437221.1.87968 WP_002437221.1.8850 WP_002437221.1.89535 WP_002437221.1.89842 WP_002437221.1.910 WP_002437221.1.91726 WP_002437221.1.92296 WP_002437221.1.92977 WP_002437221.1.94358 WP_002437221.1.95589 WP_002437221.1.9749 gi|57865965|ref|YP_187635.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]