SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_002531152.1.43449 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_002531152.1.43449
Domain Number 1 Region: 3-225
Classification Level Classification E-value
Superfamily CutC-like 6.8e-45
Family CutC-like 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_002531152.1.43449
Sequence length 228
Comment MULTISPECIES: copper homeostasis protein CutC [Propionibacteriaceae]; AA=GCF_001750535.1; RF=na; TAX=1747; STAX=1747; NAME=Cutibacterium acnes; strain=LRY_BL; AL=Contig; RT=Major
Sequence
MALLEVICLHEHDAKRAAAGGADRIELVGTMDDGGLAPSPELLARTLSAVHIPVRPMLRL
DGGFRADPRRRDEILRLASAYRDLGADGPVLGFLDEATGVDVETVIELTEGCQRWTFHRA
IDNCLEPDKAWAQLLGLHGLDQVLTAGSPRGVEHGLDDLIARASADLRVADLIMAGGGLC
AEHVPWLYRAGVRAFHIGSPARPQGSWKAWVDADLVRSWRDLLDRLAG
Download sequence
Identical sequences A0A2I1W8Q5
WP_002531152.1.101196 WP_002531152.1.18363 WP_002531152.1.28533 WP_002531152.1.31624 WP_002531152.1.43449 WP_002531152.1.49294 WP_002531152.1.50533 WP_002531152.1.56454 WP_002531152.1.67213 WP_002531152.1.74746 WP_002531152.1.80166 gi|387502841|ref|YP_005944070.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]