SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_002551706.1.70637 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_002551706.1.70637
Domain Number 1 Region: 5-180
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 4.87e-36
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_002551706.1.70637
Sequence length 182
Comment MULTISPECIES: cytochrome b [Pseudomonas]; AA=GCF_001538205.1; RF=na; TAX=129136; STAX=317; NAME=Pseudomonas syringae pv. broussonetiae; strain=CFBP 5140; AL=Contig; RT=Major
Sequence
MQLRNSSSRYGLVSMVLHWGVAAVVFGMFALGLWMVGLDYYDTWRKAGPDLHKSIGITLF
AIMLIRVVWRLLSPPPPPLTSYSKLTRIGAAFGHLFLYVALFAVMFAGYLISTADGVGIP
VFGLFDVPALVSGLPDQAETAGWIHLYLAWVIVIFAGLHGLAALKHHFIDRDVTLKRMLG
RN
Download sequence
Identical sequences A0A0N0ENF7 A0A0N0FWW2 A0A0N0G5L0 A0A0N0GJK1 A0A0N0W360 A0A0N8RAA7 A0A0N8RKK7 A0A0P9K1E3 A0A0P9KP06 A0A0P9KQY5 A0A0P9MIV8 A0A0P9NNG9 A0A0P9TB63 A0A0P9TH48 A0A0P9TSB2 A0A0P9XFN3 A0A0P9Y3U3 A0A0P9Z9Q0 A0A0Q0CWW9 A0A0Q0G483 A0A0Q0GQP4 A0A0W0INH1 A0A0W0L845 A0A0W8HIZ3 A0A108V5A1 A0A1E3XXE8 A0A1H0F5S8 A0A1H2AUC4 A0A267KLC0 F3JXQ9 Q48PB9
gi|71737860|ref|YP_272750.1| WP_002551706.1.100030 WP_002551706.1.100371 WP_002551706.1.101587 WP_002551706.1.10739 WP_002551706.1.12791 WP_002551706.1.12808 WP_002551706.1.1286 WP_002551706.1.12881 WP_002551706.1.13093 WP_002551706.1.131 WP_002551706.1.14608 WP_002551706.1.17025 WP_002551706.1.19745 WP_002551706.1.20304 WP_002551706.1.22031 WP_002551706.1.25848 WP_002551706.1.26784 WP_002551706.1.27185 WP_002551706.1.28195 WP_002551706.1.28786 WP_002551706.1.2893 WP_002551706.1.29131 WP_002551706.1.29132 WP_002551706.1.3022 WP_002551706.1.31015 WP_002551706.1.35401 WP_002551706.1.35444 WP_002551706.1.37820 WP_002551706.1.38140 WP_002551706.1.51882 WP_002551706.1.53091 WP_002551706.1.5324 WP_002551706.1.53919 WP_002551706.1.56773 WP_002551706.1.57036 WP_002551706.1.59070 WP_002551706.1.59446 WP_002551706.1.59889 WP_002551706.1.6083 WP_002551706.1.61736 WP_002551706.1.64420 WP_002551706.1.65103 WP_002551706.1.65608 WP_002551706.1.6573 WP_002551706.1.67845 WP_002551706.1.6800 WP_002551706.1.68178 WP_002551706.1.69156 WP_002551706.1.70455 WP_002551706.1.70637 WP_002551706.1.70885 WP_002551706.1.72524 WP_002551706.1.73894 WP_002551706.1.74374 WP_002551706.1.77449 WP_002551706.1.78571 WP_002551706.1.79959 WP_002551706.1.83605 WP_002551706.1.83709 WP_002551706.1.83894 WP_002551706.1.84121 WP_002551706.1.86037 WP_002551706.1.86868 WP_002551706.1.87004 WP_002551706.1.87869 WP_002551706.1.88030 WP_002551706.1.89047 WP_002551706.1.89853 WP_002551706.1.90260 WP_002551706.1.90497 WP_002551706.1.91552 WP_002551706.1.93917 264730.PSPPH_0447

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]