SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_002557154.1.72823 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_002557154.1.72823
Domain Number 1 Region: 2-85
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000706
Family Anti-sigma factor antagonist SpoIIaa 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_002557154.1.72823
Sequence length 103
Comment MULTISPECIES: hypothetical protein [Borreliella]; AA=GCF_000444465.1; RF=na; TAX=1328311; STAX=139; NAME=Borrelia burgdorferi CA382; strain=CA382; AL=Complete Genome; RT=Major
Sequence
MIYRPEGELVINSIFKVKEDLLHIFKKMKEGDTLIIDLSNVEKIDITFIQILYASNKYAK
NRNLFVKIEYPSDEVLSSLIYGGFLVDIEDVDSFDLGLNLVGF
Download sequence
Identical sequences A0A0E1UAK5 A0A0H3C1A8 A0A2J9PBL4 C0ANL1 D6RY51 O51514
gi|387827467|ref|YP_005806749.1| gi|530321466|ref|YP_008407732.1| 224326.BB0566 445985.BbuZS7_0577 NP_212700.1.46978 WP_002557154.1.100172 WP_002557154.1.1709 WP_002557154.1.18535 WP_002557154.1.20994 WP_002557154.1.22230 WP_002557154.1.22354 WP_002557154.1.23946 WP_002557154.1.24131 WP_002557154.1.24739 WP_002557154.1.30682 WP_002557154.1.31711 WP_002557154.1.35366 WP_002557154.1.38241 WP_002557154.1.38531 WP_002557154.1.41722 WP_002557154.1.42250 WP_002557154.1.44797 WP_002557154.1.53248 WP_002557154.1.54040 WP_002557154.1.58911 WP_002557154.1.66939 WP_002557154.1.6933 WP_002557154.1.70456 WP_002557154.1.72823 WP_002557154.1.75039 WP_002557154.1.7957 WP_002557154.1.85076 WP_002557154.1.86244 WP_002557154.1.91101 WP_002557154.1.95407 WP_002557154.1.96090 WP_002557154.1.96757 WP_002557154.1.99709 gi|15594911|ref|NP_212700.1| gi|387826203|ref|YP_005805656.1| gi|218249726|ref|YP_002375073.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]