SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_002557156.1.100172 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_002557156.1.100172
Domain Number 1 Region: 198-383
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 4.84e-67
Family Methylesterase CheB, C-terminal domain 0.00000199
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_002557156.1.100172
Sequence length 385
Comment transcriptional regulator [Borreliella burgdorferi]; AA=GCF_000181715.2; RF=na; TAX=476212; STAX=139; NAME=Borrelia burgdorferi 94a; strain=94a; AL=Scaffold; RT=Major
Sequence
MKILVIDIQGLIKQVFVRAFSKDNDVEILNAGFNSLNLINVFLQKFPDLVIIDENTARSN
FGNSLNNVLNNISLPVVFIAQNEMLPNFGCLEQSKEKVKLIINKLNFKLTVDLFRSKYLA
LIKLELKNLGKNKLISSFEVKRIQAPDFSSNSKVELRENNLNDSSIRKSYRVSDVINFAP
KNDPDVIIKYQGLINKHKTGKIIVVGSSTGGTEALRIFLRSFKKDSPPIIIVQHMPGGFT
KSFAKNLNNEFNIDIKEAEDGDILRPGLVIIANGSYHLIVKYSSGNYFVNLLDGPLVSRH
KPSVNVLFRSAAMYAGSNAIGVILTGMGDDGAVCMLEMKKNGAYTIAQDQETSVVFGMPM
EAIKIGAVDKILPLSEIADHVLRRS
Download sequence
Identical sequences A0A0E1U991 A0A0H3C4T9 A0A2J9PBH0 Q45047
gi|387827469|ref|YP_005806751.1| gi|218249798|ref|YP_002375075.1| gi|15594913|ref|NP_212702.1| NP_212702.1.46978 WP_002557156.1.100172 WP_002557156.1.100372 WP_002557156.1.1709 WP_002557156.1.20994 WP_002557156.1.22354 WP_002557156.1.23946 WP_002557156.1.31711 WP_002557156.1.3534 WP_002557156.1.38241 WP_002557156.1.38531 WP_002557156.1.41722 WP_002557156.1.42250 WP_002557156.1.44797 WP_002557156.1.53248 WP_002557156.1.54040 WP_002557156.1.58911 WP_002557156.1.66939 WP_002557156.1.6933 WP_002557156.1.70456 WP_002557156.1.72823 WP_002557156.1.75039 WP_002557156.1.7957 WP_002557156.1.85076 WP_002557156.1.86244 WP_002557156.1.96090 WP_002557156.1.96757 224326.BB0568 445985.BbuZS7_0579 gi|387826205|ref|YP_005805658.1| gi|530321468|ref|YP_008407734.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]