SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_002655356.1.85502 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_002655356.1.85502
Domain Number 1 Region: 219-419
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 4.17e-17
Family AmyC N-terminal domain-like 0.068
Further Details:      
 
Domain Number 2 Region: 569-931
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 0.0000000304
Family alpha-mannosidase, C-terminal domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_002655356.1.85502
Sequence length 936
Comment hypothetical protein [Blastopirellula marina]; AA=GCF_000153105.1; RF=representative genome; TAX=314230; STAX=124; NAME=Blastopirellula marina DSM 3645; strain=DSM 3645; AL=Scaffold; RT=Major
Sequence
MYQEVFILVPCHSFEDFPTHHRGDEAASLLACWSAMWRPELIAATGKMPAWARIDSPPDE
LEGRLLLIPLVSEQEMQAGFARRAKESGAKVIRKMVDRDETIAAALEGLEKPANLDEELA
ADFVALGYCYLQTELLTRQMRYSSNLDEVYFGEKLVAAAQSAVIGEAEASRVLLQTCFDV
LAEERNSFYPVDSYFLDLTLCASTTLGALASELQNAQPCNLVASGEVISLLAQSHPETAS
QLRDLLKAKKCGLVGGEFREGPLPLYDPETLLANFHDGLAAYEKHLGHRPIVYGRRRFGL
SSFLPQVLKSLGFHGAIHATMDDGKFTHSSQTKVSWQGNDGCKIDAIARPPLDASTADSF
IALFQRLSEAMDSDHVATVCFAHWPGRVSPWYEDLRRIARYSKGLGSFLTIERYFSETEL
PPYHDAFKDARYNSPYHKQAIIRRQNGPISTHRDRAVENAKYDAASNVEALTALITGHAG
PKHDPHRSWTEPAEGKSEANSADAIVAGAMNDFAAKLPRRSDPPTPSLLVANPFSYTTTT
GDDTAQLSSLPGGKAVLIAAEDKSGRHAVWETPSCGYAWLPDGGSAPSGKTQTMIKDGVL
RNEYMEVHFDPITGALQSIYDYKSRGNRLSQQLALRLPGERPPTGGQYVDPDETAIYSMM
AADSIDVISNTAAKGQIKIVGRLLNTAGHTLAQYEQVYTLWRSSRVLQVDIDLTPHEEPK
AEPWNSYFCARFAWSDGSAFLYRDQHWQRRRVDSKRIEAPNYVEIENGKTHTQVLTGGVP
FHQHVRGRMLDTILIPRGETARTFRLGIGIDLPYPLQEARRLTYNPPPRVENAPSPTPGD
TSWALHIDAKNVVITALIPLTKGEQVVGFSVRLLETEGRAAKGNLRCFRNVGRAILTEFN
GESTGAAKTSEDRVQFDLHPEEWRQIDVYWEEEAKG
Download sequence
Identical sequences A3ZL53
WP_002655356.1.85502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]