SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_002758831.1.7764 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_002758831.1.7764
Domain Number 1 Region: 1-149
Classification Level Classification E-value
Superfamily Ribosomal protein S7 8.63e-60
Family Ribosomal protein S7 0.00000387
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_002758831.1.7764
Sequence length 156
Comment MULTISPECIES: 30S ribosomal protein S7 [Microcystis]; AA=GCF_000312725.1; RF=na; TAX=1160282; STAX=1126; NAME=Microcystis aeruginosa PCC 9806; strain=PCC 9806; AL=Scaffold; RT=Major
Sequence
MSRRKNVKKRPIPPDPVYNSCLVSMTIRRIMRSGKKSLAANIVYDALKTVGERTGQEPLE
VFEKAVKNATPLVEVKARRVGGATYQVPMEVRSNRGSTLALRWLVHYARTRGGKTMAGKL
ANEIMDAANETGGTIKKREETHRMAEANKAFAHYRY
Download sequence
Identical sequences A0A0A1VZD1 A0A0F6RNR8 A0A0K1S0U1 A0A2H6L9D2 B0JSE2 I4FLU6 I4GAE5 I4GTD0 I4I6T6 I4IDY4
449447.MAE_42780 WP_002758831.1.10452 WP_002758831.1.20667 WP_002758831.1.24258 WP_002758831.1.39664 WP_002758831.1.4043 WP_002758831.1.43975 WP_002758831.1.50331 WP_002758831.1.50673 WP_002758831.1.6707 WP_002758831.1.7764 gi|166367019|ref|YP_001659292.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]