SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_002810338.1.91979 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_002810338.1.91979
Domain Number 1 Region: 150-212
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000000275
Family NfeD domain-like 0.0073
Further Details:      
 
Weak hits

Sequence:  WP_002810338.1.91979
Domain Number - Region: 38-135
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 0.0366
Family Multidrug efflux transporter AcrB transmembrane domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_002810338.1.91979
Sequence length 214
Comment nodulation protein NodD [Nitrosococcus oceani]; AA=GCF_000012805.1; RF=representative genome; TAX=323261; STAX=1229; NAME=Nitrosococcus oceani ATCC 19707; strain=ATCC 19707; AL=Complete Genome; RT=Major
Sequence
MVRHVRVIWNTAFIGAICGSLLWLRREDIPAHLDALVLGILVGTLYGGLYWRYLFHRITR
KERRFERNRILVHYLSLFELLLTAATWSLYLLIALTLLILAAVLLDIFSGYWWSILISSF
GMAAALSLGGSIVRYERLYGALYYQYDSRSWLGGEGLLYQEGRAIQPLTPKGKIIINGEL
WHAVSLNGDNIEAGKKVEVISREGLTLYVDSLPQ
Download sequence
Identical sequences A0A0E2Z0X4 Q3J913
323261.Noc_2223 gi|77165688|ref|YP_344213.1| WP_002810338.1.20919 WP_002810338.1.77844 WP_002810338.1.91979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]