SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_002850294.1.38168 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_002850294.1.38168
Domain Number 1 Region: 120-397
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.74e-67
Family RecA protein-like (ATPase-domain) 0.0000000504
Further Details:      
 
Domain Number 2 Region: 78-151
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.57e-22
Family Cold shock DNA-binding domain-like 0.00044
Further Details:      
 
Domain Number 3 Region: 30-76
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.000000000549
Family Rho termination factor, N-terminal domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_002850294.1.38168
Sequence length 444
Comment transcription termination factor Rho [Campylobacter fetus]; AA=GCF_000759515.1; RF=na; TAX=1093099; STAX=196; NAME=Campylobacter fetus subsp. venerealis 97/608; strain=97/608; AL=Complete Genome; RT=Major
Sequence
MENKDNAQSHQSSSGAKKQHTRTHIPVDGYKIEELRQLDLDSLVAIANEVGVENPREFRR
QELVFEILKAQTKQGGFILFTGILEIVGDGYGFLRATDANLSDSANDTYVSQSQIKKFAL
RVGDIITGQVREPREQEKYYALLKIEAINYKSIAEAKERPLFDNLTPLFPNEKIKLEYDP
MKLTGRVLDLFTPIGKGQRGLIVAPPRTGKTELMKELAHGITRNHPEMELIVLLIDERPE
EVTDMQRSVKGEVFSSTFDLPAINHVRVAELVIEKAKRSVEMGKNVVILLDSITRLARAY
NTVTPSSGKVLSGGVDANALHKPKRFFGAARNIENGGSLTIVATALIDTGSRMDDVIFEE
FKGTGNSEIVLDRTISDRRIYPAVNILKSGTRKDELLQGPDDLGKIWAIRNIIATMDDIE
ALKFLYSKMLKTRDNKELLSIMNE
Download sequence
Identical sequences A0A0E1GN49 A0RQS7 W0DBW4
360106.CFF8240_1421 WP_002850294.1.1289 WP_002850294.1.1469 WP_002850294.1.16919 WP_002850294.1.17016 WP_002850294.1.36062 WP_002850294.1.38168 WP_002850294.1.39057 WP_002850294.1.41035 WP_002850294.1.42553 WP_002850294.1.42882 WP_002850294.1.44411 WP_002850294.1.46075 WP_002850294.1.46714 WP_002850294.1.48558 WP_002850294.1.51765 WP_002850294.1.5603 WP_002850294.1.59303 WP_002850294.1.60351 WP_002850294.1.62614 WP_002850294.1.63275 WP_002850294.1.68475 WP_002850294.1.71429 WP_002850294.1.74407 WP_002850294.1.77129 WP_002850294.1.77394 WP_002850294.1.81562 gi|118475004|ref|YP_892560.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]