SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_002964841.1.57925 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_002964841.1.57925
Domain Number 1 Region: 25-331
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.26e-58
Family Phosphate binding protein-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_002964841.1.57925
Sequence length 334
Comment MULTISPECIES: thiamine-binding periplasmic protein [Brucella]; AA=GCF_000414015.1; RF=na; TAX=1328342; STAX=235; NAME=Brucella abortus 82-2330; strain=82-2330; AL=Scaffold; RT=Major
Sequence
MRLLSLLTFSLFAVIGLAPAAQAKDKLTIYTYDSFVSEWGPGPKVKENFEKECDCEVNFV
ASADGVALLNRLKLEGSKTAADIVLGLDTNLTTEARASGFFAPSGIDQTNVKVPGNFKDD
IFVPYDYGYFAVVYDSEKLPNPPKSLKELVEGDPAQKIVLQDPRTATPGLGMLLWMKSVY
GDEAGAAWQKLQKRVLTVTPGWSEAYGLFTKGEAPMVLSYTTSPAYHMVVEKTDRYKALA
YPEGNYLQIELAAQTTTGAKNPLAKKFLAFMTGPGFQDLIPETNWMFPAGKTSKPLPAAF
DALPKPEKTLLIPPYEVAKNRRLWVNEWLAATSR
Download sequence
Identical sequences A0A0F6ASB9 A0A0M1WA52 A0A2I7WSE1 D7H446 Q2YLW8 Q57BC4
262698.BruAb1_1742 359391.BAB1_1770 430066.BAbS19_I16530 WP_002964841.1.100443 WP_002964841.1.101965 WP_002964841.1.102082 WP_002964841.1.10322 WP_002964841.1.10630 WP_002964841.1.10893 WP_002964841.1.11620 WP_002964841.1.12041 WP_002964841.1.12241 WP_002964841.1.13460 WP_002964841.1.13826 WP_002964841.1.14542 WP_002964841.1.14633 WP_002964841.1.15077 WP_002964841.1.16975 WP_002964841.1.17378 WP_002964841.1.18034 WP_002964841.1.18635 WP_002964841.1.19508 WP_002964841.1.19641 WP_002964841.1.20012 WP_002964841.1.20317 WP_002964841.1.22583 WP_002964841.1.2337 WP_002964841.1.24196 WP_002964841.1.24428 WP_002964841.1.24655 WP_002964841.1.24726 WP_002964841.1.25101 WP_002964841.1.25382 WP_002964841.1.25729 WP_002964841.1.26599 WP_002964841.1.2778 WP_002964841.1.2839 WP_002964841.1.2874 WP_002964841.1.2877 WP_002964841.1.28889 WP_002964841.1.31106 WP_002964841.1.31239 WP_002964841.1.32337 WP_002964841.1.32492 WP_002964841.1.32731 WP_002964841.1.33220 WP_002964841.1.33599 WP_002964841.1.33753 WP_002964841.1.34353 WP_002964841.1.35056 WP_002964841.1.35970 WP_002964841.1.37797 WP_002964841.1.38353 WP_002964841.1.39021 WP_002964841.1.39963 WP_002964841.1.40407 WP_002964841.1.40624 WP_002964841.1.40649 WP_002964841.1.40871 WP_002964841.1.41044 WP_002964841.1.41311 WP_002964841.1.41835 WP_002964841.1.42103 WP_002964841.1.42427 WP_002964841.1.43597 WP_002964841.1.4428 WP_002964841.1.45559 WP_002964841.1.46182 WP_002964841.1.46432 WP_002964841.1.4727 WP_002964841.1.47558 WP_002964841.1.47610 WP_002964841.1.4847 WP_002964841.1.49640 WP_002964841.1.50051 WP_002964841.1.50053 WP_002964841.1.50282 WP_002964841.1.5052 WP_002964841.1.5236 WP_002964841.1.53128 WP_002964841.1.53481 WP_002964841.1.5394 WP_002964841.1.54440 WP_002964841.1.54776 WP_002964841.1.54779 WP_002964841.1.55440 WP_002964841.1.55684 WP_002964841.1.56334 WP_002964841.1.56683 WP_002964841.1.56952 WP_002964841.1.57925 WP_002964841.1.58525 WP_002964841.1.58539 WP_002964841.1.59086 WP_002964841.1.59515 WP_002964841.1.61325 WP_002964841.1.61536 WP_002964841.1.61811 WP_002964841.1.61997 WP_002964841.1.63730 WP_002964841.1.64013 WP_002964841.1.64124 WP_002964841.1.64853 WP_002964841.1.64905 WP_002964841.1.65131 WP_002964841.1.65454 WP_002964841.1.6555 WP_002964841.1.65625 WP_002964841.1.66260 WP_002964841.1.66810 WP_002964841.1.67893 WP_002964841.1.67996 WP_002964841.1.67997 WP_002964841.1.68913 WP_002964841.1.69451 WP_002964841.1.69829 WP_002964841.1.70322 WP_002964841.1.71194 WP_002964841.1.71689 WP_002964841.1.71846 WP_002964841.1.7206 WP_002964841.1.72916 WP_002964841.1.75434 WP_002964841.1.75458 WP_002964841.1.75766 WP_002964841.1.76350 WP_002964841.1.76433 WP_002964841.1.77321 WP_002964841.1.77899 WP_002964841.1.78109 WP_002964841.1.78821 WP_002964841.1.7984 WP_002964841.1.79963 WP_002964841.1.80266 WP_002964841.1.80476 WP_002964841.1.80697 WP_002964841.1.81617 WP_002964841.1.81822 WP_002964841.1.82113 WP_002964841.1.8224 WP_002964841.1.8278 WP_002964841.1.8307 WP_002964841.1.85322 WP_002964841.1.85769 WP_002964841.1.8657 WP_002964841.1.87522 WP_002964841.1.87603 WP_002964841.1.87867 WP_002964841.1.8788 WP_002964841.1.8878 WP_002964841.1.90689 WP_002964841.1.91123 WP_002964841.1.91338 WP_002964841.1.91710 WP_002964841.1.92518 WP_002964841.1.93454 WP_002964841.1.93795 WP_002964841.1.94126 WP_002964841.1.94555 WP_002964841.1.94775 WP_002964841.1.97511 WP_002964841.1.97741 WP_002964841.1.98076 WP_002964841.1.98455 WP_002964841.1.99221 WP_002964841.1.99373 WP_002964841.1.99421 gi|376272518|ref|YP_005151096.1| gi|189024841|ref|YP_001935609.1| gi|82700543|ref|YP_415117.1| gi|62290628|ref|YP_222421.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]