SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_002965113.1.34353 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_002965113.1.34353
Domain Number 1 Region: 64-337
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 5.1e-75
Family L-arabinose binding protein-like 0.0000472
Further Details:      
 
Domain Number 2 Region: 6-63
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 8.91e-17
Family GalR/LacI-like bacterial regulator 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_002965113.1.34353
Sequence length 352
Comment MULTISPECIES: LacI family transcriptional regulator [Brucella]; AA=GCF_000370405.1; RF=na; TAX=1169220; STAX=235; NAME=Brucella abortus F10/06-3; strain=F10/06-3; AL=Scaffold; RT=Major
Sequence
MSKGSVTVIDIAREAGVSKSTVSLVLRDSPLVHAETRAKVQEAIEKLGYVYNRSAANLRQ
AKSKIIGLVVNDLTNSFFAELAVGVDRVMQSAGYVQFLANTAESIDRQREVIASMREHGI
AGLIVSPARGTEASDLKPLAKSGLPVVQMVRDVPGSGVSSIVSDNRGGVAKAVEHLVSLG
HRAIAFMGGYADIAVFSERLAGYRTGLEQAGIAFDEALVFTSAPSRAGGVEALEQMLRQG
MKPTAAVCFNDAVAFGVCDGLRATHLEPGQDFGVVGFDDVIEAKTAVPALTTVAVDPQGL
GERAAQLLLKQINSERVEAEAQRLSVRLAVRASCGAPFRKPEEKFEWQSGAL
Download sequence
Identical sequences A0A0F6ASZ6 A0A0M1WBY9 A0A2I7WTF7 D7H0F0 Q2YR24 Q57AK9
gi|189025108|ref|YP_001935876.1| 262698.BruAb1_2024 359391.BAB1_2050 430066.BAbS19_I19200 gi|82700804|ref|YP_415378.1| gi|62290893|ref|YP_222686.1| gi|376272233|ref|YP_005150811.1| WP_002965113.1.100443 WP_002965113.1.101965 WP_002965113.1.102082 WP_002965113.1.10322 WP_002965113.1.10630 WP_002965113.1.10893 WP_002965113.1.11620 WP_002965113.1.12041 WP_002965113.1.12241 WP_002965113.1.13460 WP_002965113.1.13826 WP_002965113.1.14542 WP_002965113.1.14633 WP_002965113.1.15077 WP_002965113.1.16975 WP_002965113.1.17378 WP_002965113.1.18034 WP_002965113.1.18635 WP_002965113.1.19641 WP_002965113.1.20012 WP_002965113.1.22583 WP_002965113.1.2337 WP_002965113.1.24196 WP_002965113.1.24428 WP_002965113.1.24655 WP_002965113.1.24726 WP_002965113.1.25101 WP_002965113.1.25382 WP_002965113.1.25729 WP_002965113.1.26599 WP_002965113.1.2778 WP_002965113.1.2839 WP_002965113.1.2874 WP_002965113.1.2877 WP_002965113.1.28889 WP_002965113.1.31239 WP_002965113.1.32337 WP_002965113.1.32492 WP_002965113.1.32731 WP_002965113.1.33220 WP_002965113.1.33599 WP_002965113.1.33753 WP_002965113.1.34353 WP_002965113.1.35056 WP_002965113.1.35970 WP_002965113.1.37797 WP_002965113.1.38353 WP_002965113.1.39021 WP_002965113.1.39039 WP_002965113.1.39963 WP_002965113.1.40407 WP_002965113.1.40624 WP_002965113.1.40649 WP_002965113.1.40871 WP_002965113.1.41044 WP_002965113.1.41311 WP_002965113.1.42103 WP_002965113.1.42427 WP_002965113.1.43597 WP_002965113.1.4428 WP_002965113.1.45559 WP_002965113.1.46182 WP_002965113.1.46432 WP_002965113.1.4727 WP_002965113.1.47558 WP_002965113.1.47610 WP_002965113.1.4847 WP_002965113.1.49640 WP_002965113.1.50051 WP_002965113.1.50053 WP_002965113.1.50282 WP_002965113.1.5052 WP_002965113.1.5236 WP_002965113.1.53128 WP_002965113.1.53481 WP_002965113.1.5394 WP_002965113.1.54440 WP_002965113.1.55440 WP_002965113.1.55684 WP_002965113.1.56334 WP_002965113.1.56952 WP_002965113.1.57925 WP_002965113.1.58525 WP_002965113.1.58539 WP_002965113.1.59086 WP_002965113.1.59515 WP_002965113.1.61325 WP_002965113.1.61536 WP_002965113.1.61811 WP_002965113.1.61997 WP_002965113.1.63730 WP_002965113.1.64124 WP_002965113.1.64853 WP_002965113.1.64905 WP_002965113.1.65131 WP_002965113.1.65454 WP_002965113.1.65625 WP_002965113.1.66078 WP_002965113.1.66260 WP_002965113.1.66810 WP_002965113.1.67893 WP_002965113.1.67996 WP_002965113.1.67997 WP_002965113.1.68913 WP_002965113.1.69451 WP_002965113.1.69829 WP_002965113.1.70322 WP_002965113.1.71194 WP_002965113.1.71689 WP_002965113.1.71846 WP_002965113.1.7206 WP_002965113.1.72916 WP_002965113.1.75458 WP_002965113.1.75766 WP_002965113.1.76350 WP_002965113.1.76433 WP_002965113.1.77321 WP_002965113.1.78109 WP_002965113.1.7984 WP_002965113.1.79963 WP_002965113.1.80266 WP_002965113.1.80476 WP_002965113.1.80697 WP_002965113.1.81617 WP_002965113.1.81822 WP_002965113.1.8224 WP_002965113.1.8278 WP_002965113.1.8307 WP_002965113.1.85322 WP_002965113.1.85769 WP_002965113.1.8657 WP_002965113.1.87522 WP_002965113.1.87603 WP_002965113.1.87867 WP_002965113.1.8788 WP_002965113.1.8878 WP_002965113.1.90689 WP_002965113.1.91123 WP_002965113.1.91338 WP_002965113.1.92518 WP_002965113.1.93454 WP_002965113.1.94126 WP_002965113.1.94555 WP_002965113.1.94775 WP_002965113.1.97511 WP_002965113.1.97741 WP_002965113.1.98076 WP_002965113.1.98455 WP_002965113.1.99221 WP_002965113.1.99373 WP_002965113.1.99421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]