SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_002965667.1.50282 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_002965667.1.50282
Domain Number 1 Region: 65-336
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 6.06e-78
Family L-arabinose binding protein-like 0.0000432
Further Details:      
 
Domain Number 2 Region: 4-62
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.0000000000000741
Family GalR/LacI-like bacterial regulator 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_002965667.1.50282
Sequence length 339
Comment MULTISPECIES: transcriptional regulator [Brucella]; AA=GCF_000742195.1; RF=na; TAX=359391; STAX=235; NAME=Brucella abortus 2308; strain=2308; AL=Scaffold; RT=Major
Sequence
MAQKIKLSTIADALGVSTATVSLALRDSPLVADQTREKIKEHARAIGYIYNRRAASLRTS
RSGIVGVVVRDIMNPFFAEILKSIETELDRSRQTFILSNHYDQLDKQRTFMDTLLQLGAD
GVIMSPAIGTPAEDIQLAEDNGLPVVLIARSVEGVHAPVFRGDNAYGIGLATNHLISLGH
TRIAMIGGTDQTSTGRDRYRGYVQAMEKAGLEVRPDWRIPGSRTKQGGFEVAPQFLALKD
KPTAAVCWNDLTAIGLMNGIARAGLVPGEDISVTGYDDLEEAAIATPALTTVWNGQREVG
RRAARALLDQLNGVEVSSTQELIRPELHIRQSTSKPKHA
Download sequence
Identical sequences A0A0F6ATV6 A0A0M1WH21 A0A2K4NNL8 D7H669 Q2YJ02 Q579J8
WP_002965667.1.100443 WP_002965667.1.101965 WP_002965667.1.102082 WP_002965667.1.10322 WP_002965667.1.10630 WP_002965667.1.10893 WP_002965667.1.11620 WP_002965667.1.12041 WP_002965667.1.12241 WP_002965667.1.13460 WP_002965667.1.13826 WP_002965667.1.14542 WP_002965667.1.14633 WP_002965667.1.15077 WP_002965667.1.16975 WP_002965667.1.17378 WP_002965667.1.18034 WP_002965667.1.18635 WP_002965667.1.19508 WP_002965667.1.19641 WP_002965667.1.20012 WP_002965667.1.20317 WP_002965667.1.22583 WP_002965667.1.2337 WP_002965667.1.24196 WP_002965667.1.24428 WP_002965667.1.24655 WP_002965667.1.24726 WP_002965667.1.25101 WP_002965667.1.25382 WP_002965667.1.25729 WP_002965667.1.26599 WP_002965667.1.2778 WP_002965667.1.2839 WP_002965667.1.2874 WP_002965667.1.2877 WP_002965667.1.28889 WP_002965667.1.31094 WP_002965667.1.31106 WP_002965667.1.31239 WP_002965667.1.32337 WP_002965667.1.32492 WP_002965667.1.32731 WP_002965667.1.33220 WP_002965667.1.33599 WP_002965667.1.33753 WP_002965667.1.34353 WP_002965667.1.35056 WP_002965667.1.35970 WP_002965667.1.37797 WP_002965667.1.38353 WP_002965667.1.39021 WP_002965667.1.39039 WP_002965667.1.39963 WP_002965667.1.40407 WP_002965667.1.40624 WP_002965667.1.40649 WP_002965667.1.40871 WP_002965667.1.41044 WP_002965667.1.41311 WP_002965667.1.41835 WP_002965667.1.42103 WP_002965667.1.42427 WP_002965667.1.43597 WP_002965667.1.4428 WP_002965667.1.45559 WP_002965667.1.46182 WP_002965667.1.46432 WP_002965667.1.4727 WP_002965667.1.47558 WP_002965667.1.47610 WP_002965667.1.4847 WP_002965667.1.49640 WP_002965667.1.50051 WP_002965667.1.50053 WP_002965667.1.50282 WP_002965667.1.5052 WP_002965667.1.5236 WP_002965667.1.53128 WP_002965667.1.53481 WP_002965667.1.5394 WP_002965667.1.54440 WP_002965667.1.54776 WP_002965667.1.54779 WP_002965667.1.55440 WP_002965667.1.55684 WP_002965667.1.56334 WP_002965667.1.56683 WP_002965667.1.56952 WP_002965667.1.57925 WP_002965667.1.58525 WP_002965667.1.58539 WP_002965667.1.59086 WP_002965667.1.59515 WP_002965667.1.61325 WP_002965667.1.61536 WP_002965667.1.61811 WP_002965667.1.61997 WP_002965667.1.63730 WP_002965667.1.64013 WP_002965667.1.64124 WP_002965667.1.64853 WP_002965667.1.64883 WP_002965667.1.64905 WP_002965667.1.65131 WP_002965667.1.65454 WP_002965667.1.6555 WP_002965667.1.65625 WP_002965667.1.66260 WP_002965667.1.66810 WP_002965667.1.67893 WP_002965667.1.67996 WP_002965667.1.67997 WP_002965667.1.68913 WP_002965667.1.69451 WP_002965667.1.69829 WP_002965667.1.70322 WP_002965667.1.71194 WP_002965667.1.71689 WP_002965667.1.71846 WP_002965667.1.7206 WP_002965667.1.72916 WP_002965667.1.75434 WP_002965667.1.75458 WP_002965667.1.75766 WP_002965667.1.76350 WP_002965667.1.76433 WP_002965667.1.77321 WP_002965667.1.77899 WP_002965667.1.78109 WP_002965667.1.78821 WP_002965667.1.7984 WP_002965667.1.79963 WP_002965667.1.80266 WP_002965667.1.80476 WP_002965667.1.80697 WP_002965667.1.81617 WP_002965667.1.81822 WP_002965667.1.82113 WP_002965667.1.8224 WP_002965667.1.8278 WP_002965667.1.8307 WP_002965667.1.85322 WP_002965667.1.85769 WP_002965667.1.8657 WP_002965667.1.87522 WP_002965667.1.87603 WP_002965667.1.87867 WP_002965667.1.8788 WP_002965667.1.8878 WP_002965667.1.90689 WP_002965667.1.91123 WP_002965667.1.91338 WP_002965667.1.91710 WP_002965667.1.92518 WP_002965667.1.93454 WP_002965667.1.93795 WP_002965667.1.94126 WP_002965667.1.94555 WP_002965667.1.94775 WP_002965667.1.97511 WP_002965667.1.97741 WP_002965667.1.98076 WP_002965667.1.98455 WP_002965667.1.99221 WP_002965667.1.99373 WP_002965667.1.99421 gi|376270801|ref|YP_005113846.1| 262698.BruAb2_0250 359391.BAB2_0250 430066.BAbS19_II02390 gi|62317194|ref|YP_223047.1| gi|189022457|ref|YP_001932198.1| gi|83269176|ref|YP_418467.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]