SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_002991076.1.69961 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_002991076.1.69961
Domain Number 1 Region: 31-281
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 6.04e-72
Family Phosphate binding protein-like 0.00000903
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_002991076.1.69961
Sequence length 281
Comment O-sialoglycoprotein endopeptidase [Streptococcus pyogenes]; AA=GCF_001369095.1; RF=na; TAX=301451; STAX=1314; NAME=Streptococcus pyogenes serotype M18; strain=CPre; AL=Contig; RT=Major
Sequence
MSFKKWIGIVGIALASTVLVACSEKQDDKNTLTIGVMTKTESDQARWDKVEELLKKDNIT
LKYKEFTDYSQPNKAVANGEVDINAFQHYNFLNNWNKENKEHLVAIADTYISPINLFSGT
SQDGKAKYKSVADLPNGAQIAVPNDATNESRALYVLQSAGLIKLNVSGDQLATIANISEN
KKKLDIKELDASQTARALVSADAAVVNNSYAVPAKIDYKTSLFKEKADDNSKQWINIIAG
QKDWEKSEKADAIKKLIKAYQTDEVKKVVEKTSNGIDVSVW
Download sequence
Identical sequences A0A0H3BWU2 Q1JNE1 Q48V79 Q5XDS9
gi|50913645|ref|YP_059617.1| gi|525809179|ref|YP_008242588.1| gi|383479457|ref|YP_005388351.1| WP_002991076.1.100536 WP_002991076.1.100577 WP_002991076.1.102005 WP_002991076.1.1042 WP_002991076.1.10776 WP_002991076.1.1208 WP_002991076.1.12667 WP_002991076.1.13499 WP_002991076.1.13702 WP_002991076.1.13803 WP_002991076.1.15156 WP_002991076.1.1526 WP_002991076.1.15301 WP_002991076.1.19471 WP_002991076.1.19566 WP_002991076.1.19969 WP_002991076.1.2016 WP_002991076.1.20768 WP_002991076.1.20957 WP_002991076.1.21068 WP_002991076.1.21420 WP_002991076.1.22005 WP_002991076.1.22309 WP_002991076.1.22610 WP_002991076.1.2271 WP_002991076.1.23344 WP_002991076.1.23345 WP_002991076.1.23784 WP_002991076.1.23879 WP_002991076.1.24700 WP_002991076.1.24800 WP_002991076.1.25243 WP_002991076.1.25549 WP_002991076.1.25570 WP_002991076.1.26216 WP_002991076.1.2644 WP_002991076.1.26775 WP_002991076.1.26942 WP_002991076.1.27012 WP_002991076.1.27096 WP_002991076.1.27947 WP_002991076.1.29494 WP_002991076.1.29586 WP_002991076.1.30208 WP_002991076.1.30259 WP_002991076.1.31038 WP_002991076.1.32327 WP_002991076.1.32791 WP_002991076.1.34661 WP_002991076.1.35136 WP_002991076.1.35416 WP_002991076.1.36559 WP_002991076.1.37580 WP_002991076.1.38426 WP_002991076.1.39245 WP_002991076.1.39950 WP_002991076.1.40253 WP_002991076.1.4028 WP_002991076.1.40473 WP_002991076.1.40861 WP_002991076.1.41304 WP_002991076.1.41398 WP_002991076.1.44171 WP_002991076.1.45787 WP_002991076.1.45887 WP_002991076.1.46237 WP_002991076.1.46364 WP_002991076.1.49289 WP_002991076.1.51111 WP_002991076.1.51270 WP_002991076.1.51729 WP_002991076.1.5255 WP_002991076.1.54255 WP_002991076.1.54994 WP_002991076.1.55020 WP_002991076.1.55040 WP_002991076.1.55942 WP_002991076.1.56127 WP_002991076.1.56335 WP_002991076.1.56879 WP_002991076.1.58073 WP_002991076.1.58327 WP_002991076.1.58465 WP_002991076.1.58955 WP_002991076.1.59139 WP_002991076.1.5959 WP_002991076.1.59712 WP_002991076.1.59971 WP_002991076.1.60269 WP_002991076.1.60435 WP_002991076.1.61127 WP_002991076.1.61350 WP_002991076.1.62083 WP_002991076.1.64024 WP_002991076.1.65729 WP_002991076.1.65801 WP_002991076.1.65831 WP_002991076.1.66344 WP_002991076.1.68080 WP_002991076.1.68302 WP_002991076.1.69171 WP_002991076.1.69338 WP_002991076.1.69536 WP_002991076.1.69602 WP_002991076.1.69961 WP_002991076.1.70332 WP_002991076.1.70768 WP_002991076.1.71085 WP_002991076.1.71274 WP_002991076.1.71931 WP_002991076.1.72175 WP_002991076.1.72799 WP_002991076.1.73416 WP_002991076.1.74388 WP_002991076.1.75746 WP_002991076.1.75979 WP_002991076.1.77464 WP_002991076.1.77721 WP_002991076.1.7902 WP_002991076.1.7969 WP_002991076.1.80116 WP_002991076.1.80549 WP_002991076.1.8063 WP_002991076.1.80675 WP_002991076.1.81017 WP_002991076.1.81515 WP_002991076.1.8309 WP_002991076.1.83533 WP_002991076.1.83949 WP_002991076.1.8445 WP_002991076.1.84548 WP_002991076.1.84888 WP_002991076.1.86460 WP_002991076.1.86840 WP_002991076.1.87115 WP_002991076.1.87245 WP_002991076.1.87596 WP_002991076.1.88297 WP_002991076.1.89166 WP_002991076.1.89421 WP_002991076.1.89617 WP_002991076.1.91031 WP_002991076.1.91222 WP_002991076.1.9206 WP_002991076.1.92390 WP_002991076.1.93434 WP_002991076.1.93887 WP_002991076.1.94658 WP_002991076.1.94718 WP_002991076.1.94792 WP_002991076.1.94988 WP_002991076.1.96236 WP_002991076.1.97076 WP_002991076.1.97489 WP_002991076.1.98310 WP_002991076.1.98562 WP_002991076.1.98938 WP_002991076.1.9914 WP_002991076.1.99282 WP_002991076.1.99582 WP_002991076.1.99639 gi|94987901|ref|YP_596002.1| gi|71902929|ref|YP_279732.1| gi|19745437|ref|NP_606573.1| gi|94991786|ref|YP_599885.1| gi|209558829|ref|YP_002285301.1| gi|139474391|ref|YP_001129107.1| 160491.SpyM51584 186103.spyM18_0314 286636.M6_Spy0299 319701.M28_Spy0263 370551.MGAS9429_Spy0270 370553.MGAS2096_Spy0289 471876.Spy49_0268 gi|383493381|ref|YP_005411057.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]