SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_003014804.1.78037 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_003014804.1.78037
Domain Number 1 Region: 10-93
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000432
Family Anti-sigma factor antagonist SpoIIaa 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_003014804.1.78037
Sequence length 97
Comment hypothetical protein [Francisella tularensis]; AA=GCF_001262115.1; RF=na; TAX=119856; STAX=263; NAME=Francisella tularensis subsp. tularensis; strain=WY96; AL=Complete Genome; RT=Major
Sequence
MITVTNHKWTIETELTLKTVANIYRNFRKNLKKIDKTWIIDFARCDRIDSAGLSLIIEYI
KYAQKNNIQIVFKNIDQKTLSLAKVHGAKTILEEYIN
Download sequence
Identical sequences A0A0B6DMW7 A0A0B6EDN6 A0A0E2ZK45 A0A0G2RMV1 Q5NEL5
gi|134301422|ref|YP_001121390.1| gi|379717859|ref|YP_005306195.1| gi|89255920|ref|YP_513282.1| gi|115314402|ref|YP_763125.1| gi|156501909|ref|YP_001427974.1| gi|379726462|ref|YP_005318648.1| WP_003014804.1.100020 WP_003014804.1.100480 WP_003014804.1.100639 WP_003014804.1.101979 WP_003014804.1.10388 WP_003014804.1.11004 WP_003014804.1.11695 WP_003014804.1.12700 WP_003014804.1.12820 WP_003014804.1.13116 WP_003014804.1.1316 WP_003014804.1.13715 WP_003014804.1.13896 WP_003014804.1.1431 WP_003014804.1.15828 WP_003014804.1.17073 WP_003014804.1.17117 WP_003014804.1.17471 WP_003014804.1.18135 WP_003014804.1.1833 WP_003014804.1.19035 WP_003014804.1.19348 WP_003014804.1.21553 WP_003014804.1.2186 WP_003014804.1.2301 WP_003014804.1.24109 WP_003014804.1.24307 WP_003014804.1.2436 WP_003014804.1.25474 WP_003014804.1.25812 WP_003014804.1.26192 WP_003014804.1.26690 WP_003014804.1.27183 WP_003014804.1.27408 WP_003014804.1.28031 WP_003014804.1.28288 WP_003014804.1.30377 WP_003014804.1.31247 WP_003014804.1.3134 WP_003014804.1.31410 WP_003014804.1.31907 WP_003014804.1.33374 WP_003014804.1.34036 WP_003014804.1.35898 WP_003014804.1.35965 WP_003014804.1.36081 WP_003014804.1.36125 WP_003014804.1.36481 WP_003014804.1.37362 WP_003014804.1.37819 WP_003014804.1.3831 WP_003014804.1.38368 WP_003014804.1.38474 WP_003014804.1.38662 WP_003014804.1.38763 WP_003014804.1.3975 WP_003014804.1.39861 WP_003014804.1.40634 WP_003014804.1.40692 WP_003014804.1.41167 WP_003014804.1.42944 WP_003014804.1.43575 WP_003014804.1.43725 WP_003014804.1.43882 WP_003014804.1.44313 WP_003014804.1.44744 WP_003014804.1.44922 WP_003014804.1.45210 WP_003014804.1.45908 WP_003014804.1.4633 WP_003014804.1.46791 WP_003014804.1.46956 WP_003014804.1.47286 WP_003014804.1.47340 WP_003014804.1.48020 WP_003014804.1.48098 WP_003014804.1.48962 WP_003014804.1.50994 WP_003014804.1.51529 WP_003014804.1.52816 WP_003014804.1.53326 WP_003014804.1.5414 WP_003014804.1.54420 WP_003014804.1.5487 WP_003014804.1.54961 WP_003014804.1.55289 WP_003014804.1.5563 WP_003014804.1.56738 WP_003014804.1.57478 WP_003014804.1.5829 WP_003014804.1.59625 WP_003014804.1.59871 WP_003014804.1.5992 WP_003014804.1.60112 WP_003014804.1.60146 WP_003014804.1.60504 WP_003014804.1.61154 WP_003014804.1.63091 WP_003014804.1.63562 WP_003014804.1.64199 WP_003014804.1.64987 WP_003014804.1.65566 WP_003014804.1.65967 WP_003014804.1.66077 WP_003014804.1.66092 WP_003014804.1.66463 WP_003014804.1.67317 WP_003014804.1.6752 WP_003014804.1.68327 WP_003014804.1.69545 WP_003014804.1.69933 WP_003014804.1.70888 WP_003014804.1.7106 WP_003014804.1.72408 WP_003014804.1.72665 WP_003014804.1.73228 WP_003014804.1.73973 WP_003014804.1.74506 WP_003014804.1.74697 WP_003014804.1.75261 WP_003014804.1.77053 WP_003014804.1.77714 WP_003014804.1.77892 WP_003014804.1.78037 WP_003014804.1.78521 WP_003014804.1.80474 WP_003014804.1.80603 WP_003014804.1.80616 WP_003014804.1.82216 WP_003014804.1.8254 WP_003014804.1.82545 WP_003014804.1.83968 WP_003014804.1.84288 WP_003014804.1.84370 WP_003014804.1.85044 WP_003014804.1.85695 WP_003014804.1.85899 WP_003014804.1.87224 WP_003014804.1.87451 WP_003014804.1.87851 WP_003014804.1.88243 WP_003014804.1.89268 WP_003014804.1.89309 WP_003014804.1.90324 WP_003014804.1.93025 WP_003014804.1.93182 WP_003014804.1.95205 WP_003014804.1.95453 WP_003014804.1.95561 WP_003014804.1.95669 WP_003014804.1.9679 WP_003014804.1.96937 WP_003014804.1.97486 WP_003014804.1.98147 WP_003014804.1.99661 YP_170527.1.84429 gi|423050250|ref|YP_007008684.1| gi|422938375|ref|YP_007011522.1| gi|385795334|ref|YP_005831740.1| gi|187931165|ref|YP_001891149.1| 119857.FTL_0513 177416.FTT_1612 393011.FTH_0510 393115.FTF1612 418136.FTW_0322 441952.FTM_0314 458234.FTA_0542 gi|56708631|ref|YP_170527.1| gi|110671103|ref|YP_667660.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]