SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_003026590.1.66463 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_003026590.1.66463
Domain Number 1 Region: 115-332,369-504
Classification Level Classification E-value
Superfamily PLP-dependent transferases 7.92e-44
Family AAT-like 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_003026590.1.66463
Sequence length 528
Comment aspartate 4-decarboxylase [Francisella tularensis]; AA=GCF_000305835.1; RF=na; TAX=1210518; STAX=263; NAME=Francisella tularensis subsp. tularensis 70102010; strain=70102010; AL=Contig; RT=Major
Sequence
MSQQDLSPFEFKDELIKLATSKADRLMLNAGRGNPNFLATIPRHAFLRLGDFALRESERS
YSYLNNVFGGLPEKKGITERFDYYCLAHDKQDGIDFLRAAISFVDDYLGINKEEFLYEMT
NAYLGCDYPSPPRILPIIEKIVMHYLREELYQNIDTPLEFDIFATEGGTAAMTYIFQSAK
INGLLNAHDKIAMITPIFSPYLEIPELPEYNNPIVHIYADEKVHWQVTDKELEKLLDPTI
KILCLVNPSNPPSVKISDLVLEKIAYIIDNHRSDLMIITDDVYATFSDDFESLFSKCAYN
TLCVYSFSKYFGATGWRIGTIALHKDNIFDKLISNLDDKKLDELDKHYSSLTTDSRTLKF
IDRLVADSRSVALNHTAGISLPQQLQMGLFALSSLLDNQNIYRKEAKDLIRRRYNILYSS
ISPKLQQSLDENNVGYYTLLDLEELSYKIYDKDFSQWLIKNHSGPETLKILATETGIVLL
PGKGFDVLHPSARVSLANLREYDYRQIGISIRQQLDNLYSQYKKQTKD
Download sequence
Identical sequences 418136.FTW_1358 WP_003026590.1.17073 WP_003026590.1.17471 WP_003026590.1.26192 WP_003026590.1.26690 WP_003026590.1.39861 WP_003026590.1.42944 WP_003026590.1.47286 WP_003026590.1.53326 WP_003026590.1.5563 WP_003026590.1.66463 WP_003026590.1.78037 gi|134302270|ref|YP_001122239.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]