SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_003029683.1.38474 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_003029683.1.38474
Domain Number 1 Region: 121-283
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 3.66e-86
Family SCOPe 0.0000244
Further Details:      
 
Domain Number 2 Region: 11-119
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 2.55e-28
Family NadC N-terminal domain-like 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_003029683.1.38474
Sequence length 287
Comment nicotinate-nucleotide diphosphorylase (carboxylating) [Francisella tularensis]; AA=GCF_000628945.1; RF=na; TAX=1341660; STAX=263; NAME=Francisella tularensis subsp. tularensis str. SCHU S4 substr. FSC237; strain=Schu S4 substr. FSC043; AL=Scaffold; RT=Major
Sequence
MADVMLNTDQINKVPNDIVTRLVRESLAEDIATGDITAQLAEDIDTTAFCITREEMILCG
QDFANEVINQLDKNIQITWLYSDAQKVPANARIFELKGNVRSILTAERTILNFIQMLSGT
ATVTNKLVKLISQYKTKLLDTRKTIPGFRLAQKYAVRCGGGFNHRIGLFDAYLIKENHIR
SAGGIAKAVTKAKKLDSNKVVEVEVTNLDELNQAIAAKADIVMLDNFSGEDIDIAVSIAR
GKVALEVSGNIDRNSIVAIAKTGVDFISVGAITKHIKAIDLSLQVQL
Download sequence
Identical sequences A0A0E2ZKD6 A0A0G2RPG6 Q5NEY8
3tqv_A 3tqv_B gi|385795186|ref|YP_005831592.1| 177416.FTT_1468c 393115.FTF1468c gi|56708508|ref|YP_170404.1| WP_003029683.1.101979 WP_003029683.1.10388 WP_003029683.1.11695 WP_003029683.1.1833 WP_003029683.1.2301 WP_003029683.1.25812 WP_003029683.1.31410 WP_003029683.1.35965 WP_003029683.1.3831 WP_003029683.1.38368 WP_003029683.1.38474 WP_003029683.1.38662 WP_003029683.1.44744 WP_003029683.1.52816 WP_003029683.1.56738 WP_003029683.1.5829 WP_003029683.1.59625 WP_003029683.1.60146 WP_003029683.1.61154 WP_003029683.1.65967 WP_003029683.1.66092 WP_003029683.1.67317 WP_003029683.1.75261 WP_003029683.1.80616 WP_003029683.1.82545 WP_003029683.1.87851 WP_003029683.1.98147 YP_170404.1.84429 gi|110670979|ref|YP_667536.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]