SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_003139042.1.78288 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_003139042.1.78288
Domain Number 1 Region: 400-485
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000122
Family Anti-sigma factor antagonist SpoIIaa 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_003139042.1.78288
Sequence length 495
Comment MULTISPECIES: sodium-independent anion transporter [Pseudomonas]; AA=GCF_002194135.1; RF=na; TAX=287; STAX=287; NAME=Pseudomonas aeruginosa; strain=836; AL=Contig; RT=Major
Sequence
MLQTLKQNWFSNIRGDLLAGLVVALALIPEAIAFSIIAGVDPKIGLYASFSMAVVIAFAG
GRPGMISAATGAMALLMVNLVKDHGLQYLLAATLLCGVLQILAGYLRLGSLMRFVSRSVV
TGFVNALAILIFMAQLPELTDVGWPVYAMTAAGLAIVYGFPHLPRIGRLLPSPLVCILVL
TGISIYLGLDIRTVGDMGQLPDSLPLFLWPDVPLNLDTLLIVLPYSAALAVVGLLESLMT
ATIVDEMTDTGSDKNRECKGQGLANIATGLLGGMAGSAMIGQSVINVKSGGRSRLSTLVA
GVTLLLMVVFLSDWVGRIPMAALVAVMIMVSIGTFRWESIRNLKRYPLSTNLVMLVTVGV
VLATHNLAFGVVAGVLLASLFFANKIGHYLDIDSERSADGTRRHYQVSGQVFFASSGRFV
AAFDLKETLEHVLIDLRHAHLWDVTAVAALDKVVLGFRQRGVQADVLGLNAASATLVDRF
GAYDKPGAVDILSDH
Download sequence
Identical sequences A0A0H2ZBW2 A0A157WHU1
208963.PA14_31380 WP_003139042.1.100278 WP_003139042.1.10248 WP_003139042.1.10575 WP_003139042.1.10895 WP_003139042.1.11318 WP_003139042.1.12150 WP_003139042.1.13085 WP_003139042.1.13718 WP_003139042.1.13743 WP_003139042.1.14251 WP_003139042.1.16751 WP_003139042.1.16811 WP_003139042.1.17108 WP_003139042.1.17177 WP_003139042.1.17223 WP_003139042.1.18156 WP_003139042.1.18157 WP_003139042.1.18440 WP_003139042.1.18508 WP_003139042.1.18907 WP_003139042.1.19089 WP_003139042.1.19199 WP_003139042.1.19351 WP_003139042.1.19640 WP_003139042.1.2012 WP_003139042.1.20825 WP_003139042.1.20880 WP_003139042.1.20890 WP_003139042.1.24413 WP_003139042.1.2530 WP_003139042.1.28757 WP_003139042.1.30563 WP_003139042.1.30615 WP_003139042.1.31457 WP_003139042.1.31563 WP_003139042.1.31655 WP_003139042.1.32359 WP_003139042.1.33047 WP_003139042.1.33294 WP_003139042.1.33438 WP_003139042.1.33833 WP_003139042.1.34556 WP_003139042.1.35442 WP_003139042.1.35968 WP_003139042.1.36064 WP_003139042.1.36267 WP_003139042.1.373 WP_003139042.1.37571 WP_003139042.1.38023 WP_003139042.1.38816 WP_003139042.1.39765 WP_003139042.1.40442 WP_003139042.1.41110 WP_003139042.1.41429 WP_003139042.1.42316 WP_003139042.1.42499 WP_003139042.1.42870 WP_003139042.1.43286 WP_003139042.1.43756 WP_003139042.1.43998 WP_003139042.1.44486 WP_003139042.1.44725 WP_003139042.1.45604 WP_003139042.1.45700 WP_003139042.1.46306 WP_003139042.1.48472 WP_003139042.1.48851 WP_003139042.1.49108 WP_003139042.1.49806 WP_003139042.1.51957 WP_003139042.1.52500 WP_003139042.1.52850 WP_003139042.1.55387 WP_003139042.1.55813 WP_003139042.1.56626 WP_003139042.1.57020 WP_003139042.1.57369 WP_003139042.1.58200 WP_003139042.1.58360 WP_003139042.1.58510 WP_003139042.1.58800 WP_003139042.1.58944 WP_003139042.1.60084 WP_003139042.1.60472 WP_003139042.1.62703 WP_003139042.1.63739 WP_003139042.1.64544 WP_003139042.1.6461 WP_003139042.1.64886 WP_003139042.1.65312 WP_003139042.1.65457 WP_003139042.1.65632 WP_003139042.1.66155 WP_003139042.1.68172 WP_003139042.1.68499 WP_003139042.1.68979 WP_003139042.1.70537 WP_003139042.1.71249 WP_003139042.1.7163 WP_003139042.1.72920 WP_003139042.1.74281 WP_003139042.1.74326 WP_003139042.1.74685 WP_003139042.1.75431 WP_003139042.1.75603 WP_003139042.1.76077 WP_003139042.1.76141 WP_003139042.1.76775 WP_003139042.1.78118 WP_003139042.1.78288 WP_003139042.1.79754 WP_003139042.1.8038 WP_003139042.1.80683 WP_003139042.1.81426 WP_003139042.1.81470 WP_003139042.1.81856 WP_003139042.1.81874 WP_003139042.1.81927 WP_003139042.1.83440 WP_003139042.1.83460 WP_003139042.1.83503 WP_003139042.1.83540 WP_003139042.1.84558 WP_003139042.1.85150 WP_003139042.1.85638 WP_003139042.1.85920 WP_003139042.1.86665 WP_003139042.1.86796 WP_003139042.1.86970 WP_003139042.1.8785 WP_003139042.1.87888 WP_003139042.1.88540 WP_003139042.1.89480 WP_003139042.1.91392 WP_003139042.1.92630 WP_003139042.1.93568 WP_003139042.1.93889 WP_003139042.1.94078 WP_003139042.1.94333 WP_003139042.1.95782 WP_003139042.1.96058 WP_003139042.1.961 WP_003139042.1.985 WP_003139042.1.98873 WP_003139042.1.99065 WP_003139042.1.99378 WP_003139042.1.99772 gi|116050509|ref|YP_790672.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]