SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_003150997.1.101182 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_003150997.1.101182
Domain Number 1 Region: 22-183
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.00000000147
Family Phosphate binding protein-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_003150997.1.101182
Sequence length 204
Comment MULTISPECIES: bacilysin biosynthesis protein BacA [Bacillus]; AA=GCF_002243325.1; RF=na; TAX=492670; STAX=492670; NAME=Bacillus velezensis; strain=SCDB 291; AL=Complete Genome; RT=Major
Sequence
MIILDNSIQTKSKAYSISKLITINTLGPEGTSSEYAAKNFITNFTLLQGVNSKLSLHDTF
ESCIEKTLQSPLEYTIVPHAYDGIKHFYMRPDLQLLQIFRCDTPMYGLAVRPGFEYTDDM
LDKTVIVSHPSPINLIKYFTRKDVTFDLVNSTSAAAKRVKDGLSDIALTNELARQKYGLH
FVKTFKSIPMSWSLFGKGEIHDEN
Download sequence
Identical sequences A0A0U0D5F1 A0A2G7TQH4
gi|568179192|ref|YP_008951994.1| WP_003150997.1.101182 WP_003150997.1.101474 WP_003150997.1.11256 WP_003150997.1.21864 WP_003150997.1.23363 WP_003150997.1.24042 WP_003150997.1.24336 WP_003150997.1.27978 WP_003150997.1.3071 WP_003150997.1.34883 WP_003150997.1.35373 WP_003150997.1.35817 WP_003150997.1.36989 WP_003150997.1.37657 WP_003150997.1.4124 WP_003150997.1.44318 WP_003150997.1.44634 WP_003150997.1.45361 WP_003150997.1.46685 WP_003150997.1.4883 WP_003150997.1.48909 WP_003150997.1.49114 WP_003150997.1.52667 WP_003150997.1.55276 WP_003150997.1.55373 WP_003150997.1.5788 WP_003150997.1.58623 WP_003150997.1.61124 WP_003150997.1.72983 WP_003150997.1.72986 WP_003150997.1.75310 WP_003150997.1.77593 WP_003150997.1.78242 WP_003150997.1.80280 WP_003150997.1.80690 WP_003150997.1.90093 WP_003150997.1.93153 WP_003150997.1.97374 WP_003150997.1.97917 gi|556559379|ref|YP_008728914.1| gi|451345072|ref|YP_007443703.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]