SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_003178015.1.71919 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_003178015.1.71919
Domain Number 1 Region: 387-478
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000051
Family Anti-sigma factor antagonist SpoIIaa 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_003178015.1.71919
Sequence length 488
Comment MULTISPECIES: sodium-independent anion transporter [Bacillus]; AA=GCF_002074095.1; RF=na; TAX=1402; STAX=1402; NAME=Bacillus licheniformis; strain=SCDB 14; AL=Complete Genome; RT=Major
Sequence
MNVKQLNSEWFSNVRGDILSGIVVALALIPEAIAFSIIAGVDPMVGLYASFCIAVVISFT
GGRPAMISAATGAMALLMGTLVRDHGLDYLFAATILTGIIQLIFGVLKIARFMKFIPRSV
MVGFVNALAILIFMAQVPHFVGVSNMTYVVAGITLLIIYVLPRFTKAVPSALVAIIAMTV
FAIFGHFDLRTVGDLGEMKQSLPAFMIPNIPFNFETLAIIFPTAFALSIVGLLESLLTSS
IVDDMTDTESDKNRESRGQGIANIVAGFFGGMAGCAMIGQSVINVKSGGRGRLSTFVAGV
FLMFLIMVLGDWVVQIPMAALAGVMIMVSIGTFDWSSFSMLRKVPLTDSIVMIVTVVTVV
ATHDLSKGVFAGVILSAIFFVAKISKLKIEEKSEENAVKYIIKGQVFFASVQDFVNSFKT
GEQTKKVILDFSEAHIWDDSAVAAIDKVVLKMKEQGIDVDLIGLNESSWKLVEKLATYDQ
PHRSVSNH
Download sequence
Identical sequences A0A1Y0YM93 Q65CP7 T5HIR0
GO.9124 gi|404491512|ref|YP_006715618.1| 279010.BL00096 gi|52082632|ref|YP_081423.1| WP_003178015.1.10695 WP_003178015.1.12567 WP_003178015.1.1290 WP_003178015.1.20727 WP_003178015.1.21456 WP_003178015.1.22930 WP_003178015.1.27377 WP_003178015.1.27603 WP_003178015.1.27836 WP_003178015.1.30581 WP_003178015.1.31090 WP_003178015.1.31877 WP_003178015.1.34504 WP_003178015.1.34863 WP_003178015.1.34956 WP_003178015.1.35726 WP_003178015.1.35764 WP_003178015.1.42641 WP_003178015.1.46361 WP_003178015.1.46635 WP_003178015.1.47006 WP_003178015.1.48016 WP_003178015.1.50447 WP_003178015.1.54544 WP_003178015.1.55910 WP_003178015.1.57471 WP_003178015.1.62441 WP_003178015.1.62618 WP_003178015.1.64701 WP_003178015.1.719 WP_003178015.1.71919 WP_003178015.1.7403 WP_003178015.1.74244 WP_003178015.1.8120 WP_003178015.1.85389 WP_003178015.1.8660 WP_003178015.1.86740 WP_003178015.1.86759 WP_003178015.1.94809 WP_003178015.1.9500 WP_003178015.1.95031 WP_003178015.1.9558 WP_003178015.1.96953 WP_003178015.1.98374 WP_003178015.1.99505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]