SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_003179130.1.20727 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_003179130.1.20727
Domain Number 1 Region: 151-245
Classification Level Classification E-value
Superfamily SpoIIaa-like 9.22e-16
Family Anti-sigma factor antagonist SpoIIaa 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_003179130.1.20727
Sequence length 275
Comment MULTISPECIES: RsbT co-antagonist protein RsbRA [Bacillus]; AA=GCF_001939525.1; RF=na; TAX=1402; STAX=1402; NAME=Bacillus licheniformis; strain=127160/7; AL=Contig; RT=Major
Sequence
MSNQAVLKFISEHQNVLAGNLADILKDLNSNMTNVKLTEHMYETISNEYIHILMNESGDG
NEKSIDTIYQFSSKAVQLGVPLKLLSSGLSAFWKHLYYEMNKDVPEDQQCYDLIWEIDKF
IEPINSEILNQYAISWEKTVALQKVALQELSAPLIPVFENITVMPLVGTIDTERAKKIME
NLLSGVVKHRSEVVLIDITGVPVVDTMVAHHIMQASEAVRLVGAKCLLVGIRPEIAQTIV
NLGIDLTQVITKNTLQKGIQTALEMTDRKIVSLEE
Download sequence
Identical sequences A0A2A5Z9W2 Q65N54 T5HZ21
WP_003179130.1.10695 WP_003179130.1.12567 WP_003179130.1.1290 WP_003179130.1.20727 WP_003179130.1.21456 WP_003179130.1.22930 WP_003179130.1.30581 WP_003179130.1.31090 WP_003179130.1.31877 WP_003179130.1.34863 WP_003179130.1.35726 WP_003179130.1.35764 WP_003179130.1.46361 WP_003179130.1.46635 WP_003179130.1.47006 WP_003179130.1.48016 WP_003179130.1.54544 WP_003179130.1.55910 WP_003179130.1.57471 WP_003179130.1.62618 WP_003179130.1.64701 WP_003179130.1.70162 WP_003179130.1.719 WP_003179130.1.71919 WP_003179130.1.74244 WP_003179130.1.8120 WP_003179130.1.85389 WP_003179130.1.8660 WP_003179130.1.86740 WP_003179130.1.86759 WP_003179130.1.94809 WP_003179130.1.95031 WP_003179130.1.98374 gi|404487875|ref|YP_006711981.1| 279010.BL02202 gi|52079002|ref|YP_077793.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]