SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_003206795.1.39650 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_003206795.1.39650
Domain Number 1 Region: 3-107
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 3.14e-32
Family Frataxin-like 0.000062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_003206795.1.39650
Sequence length 110
Comment MULTISPECIES: iron donor protein CyaY [Pseudomonas]; AA=GCF_000237065.1; RF=representative genome; TAX=1114970; STAX=294; NAME=Pseudomonas fluorescens F113; strain=F113; AL=Complete Genome; RT=Major
Sequence
MSLTEARFHDLVDATQQTLEDVFDDSGLDIDLEVSAGVLTVKFENGSQLIFSRQEPLRQL
WLAAVSGGFHFDYDEESERWMCDKSEEQLGEMLERIVKQQAGVELDFEGL
Download sequence
Identical sequences A0A0F4XLJ4 A0A160A3X4 A0A1V4F8E2 F2K6S7 G8Q5W6 I4JZI3
WP_003206795.1.1542 WP_003206795.1.16574 WP_003206795.1.22661 WP_003206795.1.35230 WP_003206795.1.35287 WP_003206795.1.35513 WP_003206795.1.39650 WP_003206795.1.47548 WP_003206795.1.48623 WP_003206795.1.50046 WP_003206795.1.55806 WP_003206795.1.57064 WP_003206795.1.58660 WP_003206795.1.63017 WP_003206795.1.68337 WP_003206795.1.70304 WP_003206795.1.93455 gi|378953594|ref|YP_005211082.1| gi|330812546|ref|YP_004357008.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]