SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_003245048.1.6139 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_003245048.1.6139
Domain Number 1 Region: 171-569
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 1.28e-101
Family beta-Lactamase/D-ala carboxypeptidase 0.0000346
Further Details:      
 
Domain Number 2 Region: 52-220
Classification Level Classification E-value
Superfamily Penicillin binding protein dimerisation domain 3.66e-44
Family Penicillin binding protein dimerisation domain 0.00084
Further Details:      
 
Domain Number 3 Region: 584-637
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000000000654
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_003245048.1.6139
Sequence length 646
Comment MULTISPECIES: stage V sporulation protein D [Bacillus]; AA=GCF_001660525.1; RF=na; TAX=135461; STAX=1423; NAME=Bacillus subtilis subsp. subtilis; strain=delta6; AL=Complete Genome; RT=Major
Sequence
MRVSNVTVRKRLLFVLLFGVIVFLIIDTRLGYVQFVMGEKLTSLAKDSWSRNLPFEPERG
EILDRNGVKLATNKSAPTVFVVPRQVQNPMKTSKQLAAVLNMSEEKVYKHVTKKASIEKI
TPEGRKISNEKAKEIKALDLKGVYVAEDSIRHYPFGSFLSHVLGFAGIDNQGLLGLEAYY
DDDLKGEKGSVKFYTDAKGKKMPDEADDYTPPKDGLDMKLTVDSKVQTIMERELDNAEAK
YHPDGMIAVAMNPKNGEILGMSSRPDFDPADYQSVDPSVYNRNLPVWSTYEPGSTFKIIT
LAAALEEQKVNLKRDQFYDKGHAEVDGARLRCWKRGGHGLQTYLEVVQNSCNPGFVELGE
RLGKEKLFKYIKDFGFGQKTGIDLQGEGTGILFPLERVGPVEQATTAFGQGVSVTPIQQV
AAVSAAVNGGTLYTPYIAKEWIDPVTKKTVKKQSPIAKKQVISEETSKQIRYALESVVAE
GTGRNAFVEGYRVGGKTGTAQKVKDGKYLENNHIVSFIGFAPADDPSLVVYVAVDNPKGT
IQFGGTVAAPIVGNIMRDSLPELGVKPRKNQIEKKYQWNDTKTIEVPNVVGMSVSDLESL
LVNLNVDASGKGSKIVKQSPAAGTKVKEGSKIRVYLTEEDEKEAAD
Download sequence
Identical sequences A0A063XFD8 A0A0T8PRR4 A0A125UHI4 A0A199WGZ3 A0A1X7D9G6 A0A285JYY7 L8AJE5 Q03524 U1ZDA2
gi|321315280|ref|YP_004207567.1| 224308.BSU15170 gi|402775762|ref|YP_006629706.1| NP_389400.2.22788 WP_003245048.1.100042 WP_003245048.1.101301 WP_003245048.1.11257 WP_003245048.1.1140 WP_003245048.1.12644 WP_003245048.1.12759 WP_003245048.1.1358 WP_003245048.1.14761 WP_003245048.1.15902 WP_003245048.1.16291 WP_003245048.1.18944 WP_003245048.1.19261 WP_003245048.1.20099 WP_003245048.1.21045 WP_003245048.1.25531 WP_003245048.1.27372 WP_003245048.1.27660 WP_003245048.1.31028 WP_003245048.1.32219 WP_003245048.1.32420 WP_003245048.1.32861 WP_003245048.1.33846 WP_003245048.1.34621 WP_003245048.1.36189 WP_003245048.1.37074 WP_003245048.1.39562 WP_003245048.1.39605 WP_003245048.1.40859 WP_003245048.1.42762 WP_003245048.1.43852 WP_003245048.1.44140 WP_003245048.1.44184 WP_003245048.1.45019 WP_003245048.1.47157 WP_003245048.1.5262 WP_003245048.1.52860 WP_003245048.1.54596 WP_003245048.1.56274 WP_003245048.1.56411 WP_003245048.1.57184 WP_003245048.1.57201 WP_003245048.1.5726 WP_003245048.1.6139 WP_003245048.1.63795 WP_003245048.1.65188 WP_003245048.1.65223 WP_003245048.1.65841 WP_003245048.1.71916 WP_003245048.1.72999 WP_003245048.1.74782 WP_003245048.1.76977 WP_003245048.1.78686 WP_003245048.1.78811 WP_003245048.1.79046 WP_003245048.1.79712 WP_003245048.1.79987 WP_003245048.1.80832 WP_003245048.1.81116 WP_003245048.1.81747 WP_003245048.1.82722 WP_003245048.1.84556 WP_003245048.1.87300 WP_003245048.1.88042 WP_003245048.1.88382 WP_003245048.1.88591 WP_003245048.1.89000 WP_003245048.1.90830 WP_003245048.1.9164 WP_003245048.1.91723 WP_003245048.1.93073 WP_003245048.1.94199 WP_003245048.1.95009 WP_003245048.1.96043 WP_003245048.1.979 WP_003245048.1.99399 gi|470161697|ref|YP_007533472.1| gi|560128612|ref|YP_008829753.1| gi|255767347|ref|NP_389400.2| gi|384175259|ref|YP_005556644.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]