SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_003246590.1.36189 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_003246590.1.36189
Domain Number 1 Region: 335-666
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 1.32e-78
Family beta-Lactamase/D-ala carboxypeptidase 0.000000244
Further Details:      
 
Domain Number 2 Region: 148-334
Classification Level Classification E-value
Superfamily Penicillin binding protein dimerisation domain 5.1e-40
Family Penicillin binding protein dimerisation domain 0.0000838
Further Details:      
 
Domain Number 3 Region: 28-146
Classification Level Classification E-value
Superfamily NTF2-like 2.28e-31
Family Penicillin binding protein 2a (PBP2A), N-terminal domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_003246590.1.36189
Sequence length 668
Comment MULTISPECIES: penicillin-binding protein 3 [Bacillus]; AA=GCF_000953615.1; RF=na; TAX=1423; STAX=1423; NAME=Bacillus subtilis; strain=BS49; AL=Complete Genome; RT=Major
Sequence
MLKKCILLVFLCVGLIGLIGCSKTDSPEDRMEAFVKQWNDQQFDDMYQSLTKDVKKEISK
KDFVNRYKAIYEQAGVKNLKVTAGEVDKDDQDNKTMKHIPYKVSMNTNAGKVSFKNTAVL
KLEKTDDEESWNIDWDPSFIFKQLADDKTVQIMSIEPKRGQIYDKNGKGLAVNTDVPEIG
IVPGELGDKKEKVIKELAKKLDLTEDDIKKKLDQGWVKDDSFVPLKKVKPDQEKLVSEAT
SLQGVTRTNVSSRYYPYGEKTAHLTGYVRAITAEELKKKKEGTYSDTSNIGIAGLENVYE
DKLRGTTGWKIYVPQTGEVIAEKKAKDGEDLHLTIDIKTQMKLYDELKDDSGAAVALQPK
TGETLALVSAPSYDPNGFIFGWSDKEWKKLNKDKNNPFSAKFNKTYAPGSTIKPIAAAIG
IKNGTLKADEKKTIKGKEWQKDSSWGGYSVTRVSERLQQVDLENALITSDNIYFAQNALD
MGADTFTKGLKTFGFSEDVPYEFPIQKSSIANDKLDSDILLADTGYGQGQMQMSPLHLAT
AYTPFVDNGDLVKPTLIKKDSQTADVWHKQVVTKEGAADITKGLKGVVEDERGSAYQPVV
KGITVAGKTGTAELKTSKDDKDGTENGWFVGYDYENKDLLVAMMIQNVQDRGGSHYVVEK
AKKQFQSN
Download sequence
Identical sequences A0A162QUZ6 A0A1B2B206 P42971
gi|560127448|ref|YP_008828589.1| NP_388295.1.22788 WP_003246590.1.11257 WP_003246590.1.1140 WP_003246590.1.12759 WP_003246590.1.15902 WP_003246590.1.16291 WP_003246590.1.18944 WP_003246590.1.19261 WP_003246590.1.20099 WP_003246590.1.27372 WP_003246590.1.27660 WP_003246590.1.2914 WP_003246590.1.32219 WP_003246590.1.32420 WP_003246590.1.33846 WP_003246590.1.36189 WP_003246590.1.39605 WP_003246590.1.40859 WP_003246590.1.44140 WP_003246590.1.44184 WP_003246590.1.45019 WP_003246590.1.47157 WP_003246590.1.56274 WP_003246590.1.56411 WP_003246590.1.57201 WP_003246590.1.5726 WP_003246590.1.57513 WP_003246590.1.6139 WP_003246590.1.6517 WP_003246590.1.65188 WP_003246590.1.65223 WP_003246590.1.72999 WP_003246590.1.76977 WP_003246590.1.78686 WP_003246590.1.81116 WP_003246590.1.81747 WP_003246590.1.82722 WP_003246590.1.88042 WP_003246590.1.91723 WP_003246590.1.93420 WP_003246590.1.94199 WP_003246590.1.96043 WP_003246590.1.979 gi|16077481|ref|NP_388295.1| gi|470160570|ref|YP_007532345.1| gi|402774659|ref|YP_006628603.1| 224308.BSU04140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]