SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_003253422.1.68974 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_003253422.1.68974
Domain Number - Region: 210-298
Classification Level Classification E-value
Superfamily OMPA-like 0.00863
Family Outer membrane protein 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_003253422.1.68974
Sequence length 447
Comment MULTISPECIES: outer membrane porin, OprD family [Gammaproteobacteria]; AA=GCF_001042985.1; RF=na; TAX=86185; STAX=86185; NAME=Pseudomonas lundensis; strain=DSM 6252; AL=Contig; RT=Major
Sequence
MKIKVPLYLAAVSALSGSYAISAQAEDKPEGFIEGSSLTVLNRNFYFNRDNRDSTAPTYN
SGKGNTNGYSEAWAHAIISKFNSGFTQGTVGFGVDAFAMIGLKLDTGDGRNGGRSSFDVL
PVDNKGEARDEYTKVGGAAKVRLFDTIVKVGDVFPSTPVVASGDSRLLPESFRGVTVENT
SIQGLTLQGGRLHAMSQPVSSNLNDNFVTFYGGPVNSPWIGYGGGDYSINDNWTVSVYAS
QLKDVWNQYYAGTSVVYPLSDDLALIGGFNYYKAVDEGKKRLGEFDNNIWSAKVGVRYGA
HTLALSHQRNNGDDDFDYLRQSDSIFVDNSIQYSDFNSPKERSWMLRYDLNFTSYGIPGL
TFMTRYARGSGADYSNANQFYMRTDDNGNPLDNQKRWERDVEVKYVVQTGPAKDLSFRLR
QATTRATAFESDLDETRVIIEYPLSIL
Download sequence
Identical sequences A0A088NSF8 A0A0A7PUA7 A0A0B5K7X9 A0A0C1KCT4 A0A0E9ZRU7 A0A0N8HEB5 A0A132GDN2 A0A136QDG3 A0A142N2M5 A0A160J3N6 A0A173HM90 A0A1F1Q1C6 A0A1H3RWR8 A0A246GYJ0 A0A263SNN4 A0A2D2M0M5 A0A2G0WNB3 A0A2G2P015 A0A2G8MWN7 A5VWH5 B0KF06 B1J402 I3UV40 I7CF63 L0FCV6 Q88RT3 U5V7V7 V7D2M6 V9QNZ5 V9V737
NYSGXRC-10383l gi|568137026|ref|YP_008929611.1| gi|557220781|ref|YP_008760996.1| 160488.PP_0046 351746.Pput_0060 390235.PputW619_0063 76869.PputGB1_0060 gi|568190169|ref|YP_008962868.1| gi|148545317|ref|YP_001265419.1| gi|431800067|ref|YP_007226970.1| NP_742216.1.35174 WP_003253422.1.100418 WP_003253422.1.100978 WP_003253422.1.10374 WP_003253422.1.10502 WP_003253422.1.1079 WP_003253422.1.1090 WP_003253422.1.13892 WP_003253422.1.16466 WP_003253422.1.16675 WP_003253422.1.17606 WP_003253422.1.18387 WP_003253422.1.23231 WP_003253422.1.23948 WP_003253422.1.24892 WP_003253422.1.27009 WP_003253422.1.28157 WP_003253422.1.28295 WP_003253422.1.28354 WP_003253422.1.28475 WP_003253422.1.30459 WP_003253422.1.3142 WP_003253422.1.32932 WP_003253422.1.33269 WP_003253422.1.33725 WP_003253422.1.34630 WP_003253422.1.35996 WP_003253422.1.36333 WP_003253422.1.41 WP_003253422.1.42045 WP_003253422.1.44137 WP_003253422.1.46469 WP_003253422.1.46713 WP_003253422.1.48025 WP_003253422.1.48716 WP_003253422.1.52680 WP_003253422.1.54338 WP_003253422.1.5613 WP_003253422.1.57623 WP_003253422.1.57632 WP_003253422.1.58218 WP_003253422.1.60844 WP_003253422.1.62773 WP_003253422.1.62816 WP_003253422.1.63116 WP_003253422.1.6330 WP_003253422.1.65173 WP_003253422.1.65540 WP_003253422.1.65739 WP_003253422.1.68974 WP_003253422.1.71439 WP_003253422.1.71677 WP_003253422.1.72006 WP_003253422.1.72310 WP_003253422.1.7435 WP_003253422.1.74642 WP_003253422.1.75189 WP_003253422.1.76632 WP_003253422.1.7826 WP_003253422.1.78345 WP_003253422.1.79655 WP_003253422.1.80759 WP_003253422.1.81634 WP_003253422.1.83615 WP_003253422.1.83830 WP_003253422.1.83952 WP_003253422.1.87386 WP_003253422.1.90874 WP_003253422.1.9252 WP_003253422.1.93113 WP_003253422.1.95946 WP_003253422.1.96571 WP_003253422.1.96783 WP_003253422.1.99590 WP_003253422.1.99808 WP_003253422.1.9999 gi|167031081|ref|YP_001666312.1| gi|397697435|ref|YP_006535318.1| gi|26986791|ref|NP_742216.1| gi|170719250|ref|YP_001746938.1| gi|568184799|ref|YP_008957509.1| gi|512683094|ref|YP_008111074.1| gi|395446223|ref|YP_006386476.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]