SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_003259891.1.80759 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_003259891.1.80759
Domain Number 1 Region: 81-194
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 2.34e-19
Family Tetracyclin repressor-like, C-terminal domain 0.016
Further Details:      
 
Domain Number 2 Region: 5-79
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000000564
Family Tetracyclin repressor-like, N-terminal domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_003259891.1.80759
Sequence length 218
Comment MULTISPECIES: transcriptional regulator BetI [Pseudomonas]; AA=GCF_000831585.1; RF=na; TAX=70775; STAX=70775; NAME=Pseudomonas plecoglossicida; strain=NyZ12; AL=Complete Genome; RT=Major
Sequence
MPKVGMQPIRRQQLIEATLQAVDQVGLGDASIALIARLAGVSNGIISHYFRDKNGLIAAT
MGYIMNMLNEGVRARRQALTDDSPRAHLKVIIEGNFDASQVNGPAMKTWLAFWASSMHQP
DLHRLQRINDHRLYSNLCCQFRRALPLYHARKAARGLAALIDGLWLRGALSGDAFDTDQA
IRIAYEYMDLQLAKQHTLGTNDQAAEQPRTALANPAGA
Download sequence
Identical sequences A0A059UYN7 A0A099N5K4 A0A0C1I3F4 A0A0M2UNV8 A0A136QEI2 F8FWN9 J8V9K3 L0FSW8 V7DDX3 V9V908
2035953500 gi|431804886|ref|YP_007231789.1| gi|339489787|ref|YP_004704315.1| gi|568189783|ref|YP_008962471.1| WP_003259891.1.15314 WP_003259891.1.1643 WP_003259891.1.23948 WP_003259891.1.28354 WP_003259891.1.33515 WP_003259891.1.35335 WP_003259891.1.35716 WP_003259891.1.41505 WP_003259891.1.56258 WP_003259891.1.57632 WP_003259891.1.65739 WP_003259891.1.71677 WP_003259891.1.7288 WP_003259891.1.7435 WP_003259891.1.78427 WP_003259891.1.80759 WP_003259891.1.95946 WP_003259891.1.98117 gi|568184410|ref|YP_008957108.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]