SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_003357306.1.73124 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_003357306.1.73124
Domain Number 1 Region: 84-178
Classification Level Classification E-value
Superfamily Ribosomal protein L6 3.45e-36
Family Ribosomal protein L6 0.0000367
Further Details:      
 
Domain Number 2 Region: 1-83
Classification Level Classification E-value
Superfamily Ribosomal protein L6 1.99e-25
Family Ribosomal protein L6 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_003357306.1.73124
Sequence length 180
Comment 50S ribosomal protein L6 [Clostridium botulinum]; AA=GCF_001573935.1; RF=na; TAX=1491; STAX=1491; NAME=Clostridium botulinum; strain=SU1575NT; AL=Contig; RT=Major
Sequence
MSRVGKLPVAIPNGVTVTVTPDNVVTVKGPKGELVKAMSNKINIAVEDNSVVVTRDNDHK
DVRALHGLTRALVNNMVTGVNEGYVKTLELIGVGYRAQLQGKKLVLSLGFSHPVEMEAVS
GVEFEVEGGTKVKVKGIDKELVGAVAADIRKWRKPEPYKGKGIKYENEVIRRKEGKTGKK
Download sequence
Identical sequences A0A0E1QIX7 A0A175LT09 A5I7J1 A7FZ54 C1FMT6 M1ZYG9
gi|153937770|ref|YP_001389188.1| gi|148381406|ref|YP_001255947.1| gi|226950918|ref|YP_002806009.1| 413999.CBO3466 441770.CLB_3522 441771.CLC_3410 536232.CLM_3933 gi|153934090|ref|YP_001385781.1| WP_003357306.1.101508 WP_003357306.1.10598 WP_003357306.1.11051 WP_003357306.1.11430 WP_003357306.1.14220 WP_003357306.1.14863 WP_003357306.1.15773 WP_003357306.1.16702 WP_003357306.1.16999 WP_003357306.1.17634 WP_003357306.1.18143 WP_003357306.1.21778 WP_003357306.1.25111 WP_003357306.1.26119 WP_003357306.1.27088 WP_003357306.1.27859 WP_003357306.1.28409 WP_003357306.1.29491 WP_003357306.1.32894 WP_003357306.1.34822 WP_003357306.1.36253 WP_003357306.1.36784 WP_003357306.1.42818 WP_003357306.1.43055 WP_003357306.1.44945 WP_003357306.1.45672 WP_003357306.1.46754 WP_003357306.1.46996 WP_003357306.1.49536 WP_003357306.1.49637 WP_003357306.1.50688 WP_003357306.1.50747 WP_003357306.1.51228 WP_003357306.1.52140 WP_003357306.1.52741 WP_003357306.1.53318 WP_003357306.1.56340 WP_003357306.1.5655 WP_003357306.1.57003 WP_003357306.1.57050 WP_003357306.1.57120 WP_003357306.1.59839 WP_003357306.1.61167 WP_003357306.1.63111 WP_003357306.1.63218 WP_003357306.1.64959 WP_003357306.1.65258 WP_003357306.1.65534 WP_003357306.1.66957 WP_003357306.1.67470 WP_003357306.1.67940 WP_003357306.1.68124 WP_003357306.1.69692 WP_003357306.1.70928 WP_003357306.1.716 WP_003357306.1.73124 WP_003357306.1.74799 WP_003357306.1.75721 WP_003357306.1.76938 WP_003357306.1.77051 WP_003357306.1.79827 WP_003357306.1.80383 WP_003357306.1.80865 WP_003357306.1.87449 WP_003357306.1.87856 WP_003357306.1.88000 WP_003357306.1.90975 WP_003357306.1.9205 WP_003357306.1.92266 WP_003357306.1.94833 WP_003357306.1.95223 WP_003357306.1.96382 WP_003357306.1.96416 WP_003357306.1.9927 YP_001255947.1.75347 YP_001389188.1.17653 gi|387819747|ref|YP_005680094.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]