SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_003359184.1.52140 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_003359184.1.52140
Domain Number 1 Region: 115-279
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 6.28e-46
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.00014
Further Details:      
 
Weak hits

Sequence:  WP_003359184.1.52140
Domain Number - Region: 77-118
Classification Level Classification E-value
Superfamily Sensory domain-like 0.00115
Family Sensory domain of two-component sensor kinase 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_003359184.1.52140
Sequence length 282
Comment chemotaxis protein [Clostridium botulinum]; AA=GCF_000730785.1; RF=na; TAX=1491; STAX=1491; NAME=Clostridium botulinum; strain=CDC48761; AL=Contig; RT=Major
Sequence
MGENRRFQSNEEILAAFKLVLPYINKIIHEDMVVGLTDLEKYAGYHRAKEFELDLPEGKP
IKGIKTIEECIKYKKETYDNIPKEVYGRAIKTIFTPIYGVNNEVIGTLSSGIDFDNNNQL
VENVQKLVENVKQVTENTAQVSEAAESLAKSGQNAISMVEELNNKKNDTSEILEFIKGIA
TQTNLLGLNAAIEAARAGESGRGFAVVAGQVRKLSDQSQEAVKNIEKILDEMNNSVNEIN
NTIGSVGAISEEQAASTEEILSRIETLNETIKNLQEFVEKYK
Download sequence
Identical sequences A0A175M6X9 A0A2G7HF77 A7GGT2 B1IK31
441772.CLI_2759 498213.CLD_1871 gi|153939603|ref|YP_001391992.1| gi|170754792|ref|YP_001782309.1| WP_003359184.1.14220 WP_003359184.1.16702 WP_003359184.1.17634 WP_003359184.1.21789 WP_003359184.1.24613 WP_003359184.1.26119 WP_003359184.1.26185 WP_003359184.1.36784 WP_003359184.1.49536 WP_003359184.1.50688 WP_003359184.1.50747 WP_003359184.1.52140 WP_003359184.1.53136 WP_003359184.1.56340 WP_003359184.1.61167 WP_003359184.1.67470 WP_003359184.1.68062 WP_003359184.1.69035 WP_003359184.1.74799 WP_003359184.1.78559 WP_003359184.1.80865 WP_003359184.1.8456 WP_003359184.1.87449 WP_003359184.1.88000 WP_003359184.1.93526 WP_003359184.1.96382 WP_003359184.1.96435 WP_003359184.1.96844 WP_003359184.1.9927

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]