SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_003382843.1.77888 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_003382843.1.77888
Domain Number 1 Region: 17-200
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.57e-54
Family Methylesterase CheB, C-terminal domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_003382843.1.77888
Sequence length 204
Comment chemotaxis protein CheB [Pseudomonas syringae]; AA=GCF_002111695.1; RF=na; TAX=103796; STAX=317; NAME=Pseudomonas syringae pv. actinidiae; strain=C70; AL=Scaffold; RT=Major
Sequence
MRTTFGDAPSSHELPVVDAIVVGASAGGVEALLKIFSYLGPDFGLPILTVLHVPEDRRSQ
LAHVFQNRLAIPVKEADDKEDIVPGTLYFAPSGYHVSVESDFSLSLSQEDRVFYSRPSID
ILFGSAADAYGPRLAGVLLTGANNDGARGLMQIKKYGGFTVIQDPSQAQVSIMPEAGLAL
HSPDYLLSLNDIGRLLVELERTAC
Download sequence
Identical sequences A0A0E2UNC8 A0A0K1DQQ2 A0A0K8M2G8 A0A0Q0E565 A0A261WE19
WP_003382843.1.101089 WP_003382843.1.101562 WP_003382843.1.10813 WP_003382843.1.11179 WP_003382843.1.11501 WP_003382843.1.13399 WP_003382843.1.13535 WP_003382843.1.14609 WP_003382843.1.15140 WP_003382843.1.15376 WP_003382843.1.18673 WP_003382843.1.19280 WP_003382843.1.2043 WP_003382843.1.21006 WP_003382843.1.2158 WP_003382843.1.22256 WP_003382843.1.2278 WP_003382843.1.23399 WP_003382843.1.25273 WP_003382843.1.25447 WP_003382843.1.25462 WP_003382843.1.25719 WP_003382843.1.25763 WP_003382843.1.25769 WP_003382843.1.25775 WP_003382843.1.27572 WP_003382843.1.28366 WP_003382843.1.29094 WP_003382843.1.29938 WP_003382843.1.3107 WP_003382843.1.31627 WP_003382843.1.32392 WP_003382843.1.33925 WP_003382843.1.34155 WP_003382843.1.34243 WP_003382843.1.36147 WP_003382843.1.36658 WP_003382843.1.37064 WP_003382843.1.381 WP_003382843.1.38291 WP_003382843.1.39561 WP_003382843.1.39745 WP_003382843.1.39752 WP_003382843.1.42849 WP_003382843.1.43260 WP_003382843.1.43591 WP_003382843.1.45049 WP_003382843.1.47589 WP_003382843.1.49357 WP_003382843.1.50205 WP_003382843.1.50828 WP_003382843.1.51453 WP_003382843.1.52 WP_003382843.1.52606 WP_003382843.1.53172 WP_003382843.1.53930 WP_003382843.1.54220 WP_003382843.1.54854 WP_003382843.1.56223 WP_003382843.1.58187 WP_003382843.1.58792 WP_003382843.1.6181 WP_003382843.1.61888 WP_003382843.1.62649 WP_003382843.1.65245 WP_003382843.1.65278 WP_003382843.1.66425 WP_003382843.1.6906 WP_003382843.1.69607 WP_003382843.1.69650 WP_003382843.1.74383 WP_003382843.1.75381 WP_003382843.1.77084 WP_003382843.1.77888 WP_003382843.1.78346 WP_003382843.1.78642 WP_003382843.1.79158 WP_003382843.1.80453 WP_003382843.1.80878 WP_003382843.1.82522 WP_003382843.1.82596 WP_003382843.1.85088 WP_003382843.1.87287 WP_003382843.1.91712 WP_003382843.1.91766 WP_003382843.1.92016 WP_003382843.1.92448 WP_003382843.1.93050 WP_003382843.1.95348 WP_003382843.1.95779 WP_003382843.1.96947 WP_003382843.1.97987

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]